|
||
|
||
General information | Expression | Regulation | Mutation | Interaction |
Basic Information |
|
---|---|
Gene ID | 4978 |
Name | OPCML |
Synonym | IGLON1|OBCAM|OPCM;opioid binding protein/cell adhesion molecule-like;OPCML;opioid binding protein/cell adhesion molecule-like |
Definition | IgLON family member 1|opioid binding protein/cell adhesion molecule-like preprotein|opioid-binding protein/cell adhesion molecule |
Position | 11q25 |
Gene Type | protein-coding |
Source | Count: 2; Pubmed_search,Generif |
Literature support | Count: 3 PubMed records as below. |
Evidence Status |
Description |
reviewed | "OPCML is a broad tumor suppressor, which is frequently inactivated by methylation in multiple malignancies." |
potential | OPCML gene promoter methylation may play an important role in the carcinogenesis of cervical carcinoma. OPCML may be a cervical carcinoma-associated candidate tumor suppressor gene. |
reviewed | OPCML at 11q25 is epigenetically inactivated and has tumor-suppressor function in epithelial ovarian cancer. |
More detail of all 3 literatures about OPCML | |
External Links |
|
Links to Entrez Gene | 4978 |
Links to all GeneRIF Items | 4978 |
Links to iHOP | 4978 |
Sequence Information |
|
Nucleotide Sequence |
>4978 : length: 1017 atgtaccatcctgcctactgggtcgtcttctcggcgacaactgccctgctcttcatccca ggagtgcccgtgcgcagcggagatgccaccttccccaaagctatggacaacgtgacggtc cggcagggggagagcgccaccctcaggtgtaccatagatgaccgggtaacccgggtggcc tggctaaaccgcagcaccatcctctacgctgggaatgacaagtggtccatagaccctcgt gtgatcatcctggtcaatacaccaacccagtacagcatcatgatccaaaatgtggatgtg tatgacgaaggtccgtacacctgctctgtgcagacagacaatcatcccaaaacgtcccgg gttcacctaatagtgcaagttcctcctcagatcatgaatatctcctcagacatcactgtg aatgagggaagcagtgtgaccctgctgtgtcttgctattggcagaccagagccaactgtg acatggagacacctgtcagtcaaggaaggccagggctttgtaagtgaggatgagtacctg gagatctctgacatcaagcgagaccagtccggggagtacgaatgcagcgcgttgaacgat gtcgctgcgcccgatgtgcggaaagtaaaaatcactgtaaactatcctccctatatctca aaagccaagaacactggtgtttcagtcggtcagaagggcatcctgagctgtgaagcctct gcagtccccatggctgaattccagtggttcaaggaagaaaccaggttagccactggtctg gatggaatgaggattgaaaacaaaggccgcatgtccactctgactttcttcaatgtttca gaaaaggattatgggaactatacttgtgtggccacgaacaagcttgggaacaccaatgcc agcatcacattgtatgggcctggagcagtcattgatggtgtaaactcggcctccagagca ctggcttgtctctggctatcagggaccctcttagcccacttcttcatcaagttttga |
Protein Sequence |
>4978 : length: 338 MYHPAYWVVFSATTALLFIPGVPVRSGDATFPKAMDNVTVRQGESATLRCTIDDRVTRVA WLNRSTILYAGNDKWSIDPRVIILVNTPTQYSIMIQNVDVYDEGPYTCSVQTDNHPKTSR VHLIVQVPPQIMNISSDITVNEGSSVTLLCLAIGRPEPTVTWRHLSVKEGQGFVSEDEYL EISDIKRDQSGEYECSALNDVAAPDVRKVKITVNYPPYISKAKNTGVSVGQKGILSCEAS AVPMAEFQWFKEETRLATGLDGMRIENKGRMSTLTFFNVSEKDYGNYTCVATNKLGNTNA SITLYGPGAVIDGVNSASRALACLWLSGTLLAHFFIKF |
Copyright © 2016-Present - The Univsersity of Texas Health Science Center at Houston Rights Reserved |