|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 5047 |
Name | PAEP |
Synonym | GD|GdA|GdF|GdS|PAEG|PEP|PP14;progestagen-associated endometrial protein;PAEP;progestagen-associated endometrial protein |
Definition | PEG|PP14 protein (placental protein 14)|alpha uterine protein|glycodelin|glycodelin-A|glycodelin-F|glycodelin-S|placental protein 14|pregnancy-associated endometrial alpha-2 globulin|pregnancy-associated endometrial alpha-2-globulin|progestagen-associated |
Position | 9q34 |
Gene Type | protein-coding |
Source | Count: 1; Generif |
Literature support | Count: 1 PubMed records as below. |
|
Evidence Status |
Description |
potential | Glycodelin-induced differentiation was associated with reduced expression of oncogenes and increased expression of tumor suppressor genes. Our results suggest that glycodelin acts as a tumor suppressor in breast cancer. |
| More detail of all 1 literatures about PAEP | |
|
External Links |
|
Links to Entrez Gene | 5047 |
Links to all GeneRIF Items | 5047 |
Links to iHOP | 5047 |
|
Sequence Information |
|
Nucleotide Sequence |
>5047 : length: 543 atgctgtgcctcctgctcaccctgggcgtggccctggtctgtggtgtcccggccatggac atcccccagaccaagcaggacctggagctcccaaagttggcagggacctggcactccatg gccatggcgaccaacaacatctccctcatggcgacactgaaggcccctctgagggtccac atcacctcactgttgcccacccccgaggacaacctggagatcgttctgcacagatgggag aacaacagctgtgttgagaagaaggtccttggagagaagactgagaatccaaagaagttc aagatcaactatacggtggcgaacgaggccacgctgctcgatactgactacgacaatttc ctgtttctctgcctacaggacaccaccacccccatccagagcatgatgtgccagtacctg gccagagtcctggtggaggacgatgagatcatgcagggattcatcagggctttcaggccc ctgcccaggcacctatggtacttgctggacttgaaacagatggaagagccgtgccgtttc tag |
Protein Sequence |
>5047 : length: 180 MLCLLLTLGVALVCGVPAMDIPQTKQDLELPKLAGTWHSMAMATNNISLMATLKAPLRVH ITSLLPTPEDNLEIVLHRWENNSCVEKKVLGEKTENPKKFKINYTVANEATLLDTDYDNF LFLCLQDTTTPIQSMMCQYLARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLKQMEEPCRF |