|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 5074 |
Name | PAWR |
Synonym | PAR4|Par-4;PRKC, apoptosis, WT1, regulator;PAWR;PRKC, apoptosis, WT1, regulator |
Definition | PRKC apoptosis WT1 regulator protein|WT1-interacting protein|prostate apoptosis response 4 protein|prostate apoptosis response protein 4|prostate apoptosis response protein PAR-4|transcriptional repressor PAR4 |
Position | 12q21 |
Gene Type | protein-coding |
Source | Count: 3; Pubmed_search,TAG,Generif |
Literature support | Count: 7 PubMed records as below. |
|
Evidence Status |
Description |
reviewed | "A novel repressor, par-4, modulates transcription and growth suppression functions of the Wilms' tumor suppressor WT1." |
potential | Down-regulation of the candidate tumor suppressor gene PAR-4 is associated with poor prognosis in breast cancer. |
reviewed | The Ras effector RASSF2 controls the PAR-4 tumor suppressor. |
potential | "Results suggest that, in breast cancer, Par-4 plays a similar tumor suppressor gene role as reported in endometrial carcinoma, and that Par-4 expression has a significant inverse association with expression of progesterone receptor." |
reviewed | The tumor suppressor Par-4 activates an extrinsic pathway for apoptosis. |
reviewed | "Par-4 is a tumor suppressor protein with a pro-apoptotic function. Epigenetic silencing of Par-4 is seen in diverse tumors, [REVIEW]". |
reviewed | Par-4 is a relevant tumor suppressor gene in human endometrial carcinogenesis. |
| More detail of all 7 literatures about PAWR | |
|
Pathways and Diseases |
|
Pathway | Coregulation of Androgen receptor activity;PID Curated;200038 |
Pathway | Ceramide signaling pathway;PID Curated;200100 |
Disease | Neuroblastoma;FunDO |
Disease | PSYCH;GAD |
Disease | Attention deficit hyperactivity disorder and conduct disorder;NHGRI |
Disease | Attention deficit hyperactivity disorder and conduct disorder;GAD |
Disease | Psychotic disorder;FunDO |
Disease | Lung cancer;FunDO |
Disease | Nasopharyngeal cancer;FunDO |
Disease | Pancreas cancer;FunDO |
Disease | Leukoencephalopathy;FunDO |
Disease | Bipolar disorder;FunDO |
|
External Links |
|
Links to Entrez Gene | 5074 |
Links to all GeneRIF Items | 5074 |
Links to iHOP | 5074 |
|
Sequence Information |
|
Nucleotide Sequence |
>5074 : length: 1023 atggcgaccggtggctaccggaccagcagcggcctcggcggcagcaccacagacttcctg gaggagtggaaggcgaaacgcgagaagatgcgcgccaagcagaaccccccgggcccggcc cccccgggagggggcagcagcgacgccgctgggaagccccccgcgggggctctgggcacc ccggcggccgccgctgccaacgagctcaacaacaacctcccgggcggcgcgccggccgca cctgccgtccccggtcccgggggcgtgaactgcgcggtcggctccgccatgctgacgcgg gcggcccccggcccgcggcggtcggaggacgagcccccagccgcctctgcctcggctgca ccgccgccccagcgtgacgaggaggagccggacggcgtcccagagaagggcaagagctcg ggccccagtgccaggaaaggcaaggggcagatcgagaagaggaagctgcgggagaagcgg cgctccaccggcgtggtcaacatccctgccgcagagtgcttagatgagtacgaagatgat gaagcagggcagaaagagcggaaacgagaagatgcaattacacaacagaacactattcag aatgaagctgtaaacttactagatccaggcagttcctatctgctacaggagccacctaga acagtttcaggcagatataaaagcacaaccagtgtctctgaagaagatgtctcaagtaga tattctcgaacagatagaagtgggttccctagatataacagggatgcaaatgtttcaggt actctggtttcaagtagcacactggaaaagaaaattgaagatcttgaaaaggaagtagta agagaaagacaagaaaacctaagacttgtgagactgatgcaagataaagaggaaatgatt ggaaaactcaaagaagaaattgatttattaaatagagacctagatgacatagaagatgaa aatgaacagctaaagcaggaaaataaaactcttttgaaagttgtgggtcagctgaccagg tag |
Protein Sequence |
>5074 : length: 340 MATGGYRTSSGLGGSTTDFLEEWKAKREKMRAKQNPPGPAPPGGGSSDAAGKPPAGALGT PAAAAANELNNNLPGGAPAAPAVPGPGGVNCAVGSAMLTRAAPGPRRSEDEPPAASASAA PPPQRDEEEPDGVPEKGKSSGPSARKGKGQIEKRKLREKRRSTGVVNIPAAECLDEYEDD EAGQKERKREDAITQQNTIQNEAVNLLDPGSSYLLQEPPRTVSGRYKSTTSVSEEDVSSR YSRTDRSGFPRYNRDANVSGTLVSSSTLEKKIEDLEKEVVRERQENLRLVRLMQDKEEMI GKLKEEIDLLNRDLDDIEDENEQLKQENKTLLKVVGQLTR |