|
||
|
||
General information | Expression | Regulation | Mutation | Interaction |
Basic Information |
|
---|---|
Gene ID | 51364 |
Name | ZMYND10 |
Synonym | BLU|FLU;zinc finger, MYND-type containing 10;ZMYND10;zinc finger, MYND-type containing 10 |
Definition | protein BLu|zinc finger MYND domain-containing protein 10|zinc finger, MYND domain containing 10 |
Position | 3p21.3 |
Gene Type | protein-coding |
Source | Count: 2; Pubmed_search,Generif |
Literature support | Count: 4 PubMed records as below. |
Evidence Status |
Description |
reviewed | Hypermethylation of RASSF1A and BLU tumor suppressor genes in non-small cell lung cancer: implications for tobacco smoking during adolescence. |
potential | "BLU, a candidate tumor suppressor gene, located at the commonly deleted region 3p21.3, is an E2F-regulated, stress-responsive gene and inactivated by both epigenetic and genetic mechanisms in nasopharyngeal carcinoma." |
potential | BLU may be one of the critical tumor suppressor genes on chromosome 3p21.3 involved in the development of nasopharyngeal carcinoma. |
potential | The 630-kb lung cancer homozygous deletion region on human chromosome 3p21.3: identification and evaluation of the resident candidate tumor suppressor genes. The International Lung Cancer Chromosome 3p21.3 tumor suppressor Gene Consortium. |
More detail of all 4 literatures about ZMYND10 | |
External Links |
|
Links to Entrez Gene | 51364 |
Links to all GeneRIF Items | 51364 |
Links to iHOP | 51364 |
Sequence Information |
|
Nucleotide Sequence |
>51364 : length: 1323 atgggagacctggaactgctgctgcccggggaagctgaagtgctggtgcggggtctgcgc agcttcccgctacgcgagatgggctccgaagggtggaaccagcagcatgagaacctggag aagctgaacatgcaagccatcctcgatgccacagtcagccagggcgagcccattcaggag ctgctggtcacccatgggaaggtcccaacactggtggaggagctgatcgcagtggagatg tggaagcagaaggtgttccctgtgttctgcagggtggaggacttcaagccccagaacacc ttccccatctacatggtggtgcaccacgaggcctccatcatcaacctcttggagacagtg ttcttccacaaggaggtgtgtgagtcagcagaagacactgtcttggacttggtagactat tgccaccgcaaactgaccctgctggtggcccagagtggctgtggtggcccccctgagggg gagggatcccaggacagcaaccccatgcaggagctgcagaagcaggcagagctgatggaa tttgagattgcactgaaggccctctcagtactacgctacatcacagactgtgtggacagc ctctctctcagcaccttgagccgtatgcttagcacacacaacctgccctgcctcctggtg gaactgctggagcatagtccctggagccggcgggaaggaggcaagctgcagcagttcgag ggcagccgttggcatactgtggccccctcagagcagcaaaagctgagcaagttggacggg caagtgtggatcgccctgtacaacctgctgctaagccctgaggctcaggcgcgctactgc ctcacaagttttgccaagggacggctactcaagcttcgggccttcctcacagacacactg ctggaccagctgcccaacctggcccacttgcagagtttcctggcccatctgaccctaact gaaacccagcctcctaagaaggacctggtgttggaacagatcccagaaatctgggagcgg ctggagcgagaaaacagaggcaagtggcaggcaattgccaagcaccagctccagcatgtg ttcagcccctcagagcaggacctgcggctgcaggcgcgaaggtgggctgagacctacagg ctggatgtgctagaggcagtggctccagagcggccccgctgtgcttactgcagtgcagag gcttctaagcgctgctcacgatgccagaatgagtggtattgctgcagggagtgccaagtc aagcactgggaaaagcatggaaagacttgtgtcctggcagcccagggtgacagagccaaa tga |
Protein Sequence |
>51364 : length: 440 MGDLELLLPGEAEVLVRGLRSFPLREMGSEGWNQQHENLEKLNMQAILDATVSQGEPIQE LLVTHGKVPTLVEELIAVEMWKQKVFPVFCRVEDFKPQNTFPIYMVVHHEASIINLLETV FFHKEVCESAEDTVLDLVDYCHRKLTLLVAQSGCGGPPEGEGSQDSNPMQELQKQAELME FEIALKALSVLRYITDCVDSLSLSTLSRMLSTHNLPCLLVELLEHSPWSRREGGKLQQFE GSRWHTVAPSEQQKLSKLDGQVWIALYNLLLSPEAQARYCLTSFAKGRLLKLRAFLTDTL LDQLPNLAHLQSFLAHLTLTETQPPKKDLVLEQIPEIWERLERENRGKWQAIAKHQLQHV FSPSEQDLRLQARRWAETYRLDVLEAVAPERPRCAYCSAEASKRCSRCQNEWYCCRECQV KHWEKHGKTCVLAAQGDRAK |
Copyright © 2016-Present - The Univsersity of Texas Health Science Center at Houston Rights Reserved |