|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 5371 |
Name | PML |
Synonym | MYL|PP8675|RNF71|TRIM19;promyelocytic leukemia;PML;promyelocytic leukemia |
Definition | RING finger protein 71|probable transcription factor PML|promyelocytic leukemia protein|promyelocytic leukemia, inducer of|protein PML|tripartite motif protein TRIM19|tripartite motif-containing protein 19 |
Position | 15q22 |
Gene Type | protein-coding |
Source | Count: 4; Pubmed_search,TAG,Generif,UniProt |
Literature support | Count: 15 PubMed records as below. |
|
Evidence Status |
Description |
reviewed | Upregulation of the PML tumor suppressor in cellular senescence triggered by diverse drugs including clinically used anti-cancer chemotherapeutics relies on stimulation of PML transcription by JAK/STAT-mediated signaling. |
reviewed | Germline variants of the promyelocytic leukemia tumor suppressor gene in patients with familial cancer. |
reviewed | Results provide insight into a dynamic pool of cytoplasmic nucleoporins that form a complex with the tumor suppressor protein PML during the G1 phase of the cell cycle. |
reviewed | E6AP promotes the degradation of the PML tumor suppressor. |
reviewed | "The existence of a proapoptotic autoregulatory feedback loop between p73, YAP, and the promyelocytic leukemia (PML) tumor suppressor gene, is shown." |
reviewed | The tumor suppressor protein PML controls apoptosis induced by the HIV-1 envelope. |
reviewed | PML tumor suppressor is regulated by HIPK2-mediated phosphorylation in response to DNA damage. |
reviewed | CK2 mediates phosphorylation and ubiquitin-mediated degradation of the PML tumor suppressor. |
reviewed | Modulation of M2-type pyruvate kinase activity by the cytoplasmic PML tumor suppressor protein. |
reviewed | Degradation of the tumor suppressor PML by Pin1 contributes to the cancer phenotype of breast cancer MDA-MB-231 cells. |
| More detail of all 15 literatures about PML | |
|
Pathways and Diseases |
|
Pathway | Endocytosis;KEGG PATHWAY;hsa04144 |
Pathway | p53 pathway;PANTHER;P00059 |
Pathway | TGF-beta receptor signaling;PID Curated;200195 |
Pathway | Ubiquitin mediated proteolysis;KEGG PATHWAY;hsa04120 |
Pathway | Direct p53 effectors;PID Curated;200101 |
Pathway | regulation of transcriptional activity by pml;PID BioCarta;100067 |
Pathway | C-MYC pathway;PID Curated;200093 |
Pathway | Pathways in cancer;KEGG PATHWAY;hsa05200 |
Pathway | mTOR signaling pathway;PID Curated;200080 |
Pathway | Acute myeloid leukemia;KEGG PATHWAY;hsa05221 |
Disease | Height;NHGRI |
Disease | Cancers;KEGG DISEASE |
Disease | Gallbaldder cancer;FunDO |
Disease | Prostate cancer;FunDO |
Disease | Acute myeloid leukemia (AML);KEGG DISEASE;H00003 |
Disease | Cancers of haematopoietic and lymphoid tissues;KEGG DISEASE |
Disease | Rheumatoid arthritis;FunDO |
Disease | Cytomegalovirus infection;FunDO |
Disease | Leukemia;FunDO |
Disease | Neuroblastoma;FunDO |
Disease | Leukemia, acute promyelocytic, PML/RARA type;OMIM |
Disease | Breast cancer;FunDO |
Disease | Leukoencephalopathy;FunDO |
Disease | Liver cancer;FunDO |
|
External Links |
|
Links to Entrez Gene | 5371 |
Links to all GeneRIF Items | 5371 |
Links to iHOP | 5371 |
|
Sequence Information |
|
Nucleotide Sequence |
>5371 : length: 1902 atggagcctgcacccgcccgatctccgaggccccagcaggaccccgcccggccccaggag cccaccatgcctccccccgagaccccctctgaaggccgccagcccagccccagccccagc cctacagagcgagcccccgcttcggaggaggagttccagtttctgcgctgccagcaatgc caggcggaagccaagtgcccgaagctgctgccttgtctgcacacgctgtgctcaggatgc ctggaggcgtcgggcatgcagtgccccatctgccaggcgccctggcccctaggtgcagac acacccgccctggataacgtctttttcgagagtctgcagcggcgcctgtcggtgtaccgg cagattgtggatgcgcaggctgtgtgcacccgctgcaaagagtcggccgacttctggtgc tttgagtgcgagcagctcctctgcgccaagtgcttcgaggcacaccagtggttcctcaag cacgaggcccggcccctagcagagctgcgcaaccagtcggtgcgtgagttcctggacggc acccgcaagaccaacaacatcttctgctccaaccccaaccaccgcacccctacgctgacc agcatctactgccgaggatgttccaagccgctgtgctgctcgtgcgcgctccttgacagc agccacagtgagctcaagtgcgacatcagcgcagagatccagcagcgacaggaggagctg gacgccatgacgcaggcgctgcaggagcaggatagtgcctttggcgcggttcacgcgcag atgcacgcggccgtcggccagctgggccgcgcgcgtgccgagaccgaggagctgatccgc gagcgcgtgcgccaggtggtagctcacgtgcgggctcaggagcgcgagctgctggaggct gtggacgcgcggtaccagcgcgactacgaggagatggccagtcggctgggccgcctggat gctgtgctgcagcgcatccgcacgggcagcgcgctggtgcagaggatgaagtgctacgcc tcggaccaggaggtgctggacatgcacggtttcctgcgccaggcgctctgccgcctgcgc caggaggagccccagagcctgcaagctgccgtgcgcaccgatggcttcgacgagttcaag gtgcgcctgcaggacctcagctcttgcatcacccaggggaaagatgcagctgtatccaag aaagccagcccagaggctgccagcactcccagggaccctattgacgttgacctgcccgag gaggcagagagagtgaaggcccaggttcaggccctggggctggctgaagcccagcctatg gctgtggtacagtcagtgcccggggcacaccccgtgccagtgtacgccttctccatcaaa ggcccttcctatggagaggatgtctccaatacaacgacagcccagaagaggaagtgcagc cagacccagtgccccaggaaggtcatcaagatggagtctgaggaggggaaggaggcaagg ttggctcggagctccccggagcagcccaggcccagcacctccaaggcagtctcaccaccc cacctggatggaccgcctagccccaggagccccgtcataggaagtgaggtcttcctgccc aacagcaaccacgtggccagtggcgccggggaggcagaggaacgcgttgtggtgatcagc agctcggaagactcagatgccgaaaactcgtcctcccgagagctggatgacagcagcagt gagtccagtgacctccagctggaaggccccagcaccctcagggtcctggacgagaacctt gctgacccccaagcagaagacagacctctggttttctttgacctcaagattgacaatgaa agtgggttctcctggggctacccccacccctttctaatttag |
Protein Sequence |
>5371 : length: 633 MEPAPARSPRPQQDPARPQEPTMPPPETPSEGRQPSPSPSPTERAPASEEEFQFLRCQQC QAEAKCPKLLPCLHTLCSGCLEASGMQCPICQAPWPLGADTPALDNVFFESLQRRLSVYR QIVDAQAVCTRCKESADFWCFECEQLLCAKCFEAHQWFLKHEARPLAELRNQSVREFLDG TRKTNNIFCSNPNHRTPTLTSIYCRGCSKPLCCSCALLDSSHSELKCDISAEIQQRQEEL DAMTQALQEQDSAFGAVHAQMHAAVGQLGRARAETEELIRERVRQVVAHVRAQERELLEA VDARYQRDYEEMASRLGRLDAVLQRIRTGSALVQRMKCYASDQEVLDMHGFLRQALCRLR QEEPQSLQAAVRTDGFDEFKVRLQDLSSCITQGKDAAVSKKASPEAASTPRDPIDVDLPE EAERVKAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSYGEDVSNTTTAQKRKCS QTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLP NSNHVASGAGEAEERVVVISSSEDSDAENSSSRELDDSSSESSDLQLEGPSTLRVLDENL ADPQAEDRPLVFFDLKIDNESGFSWGYPHPFLI |