|
||
|
||
General information | Expression | Regulation | Mutation | Interaction |
Basic Information |
|
---|---|
Gene ID | 5653 |
Name | KLK6 |
Synonym | Bssp|Klk7|PRSS18|PRSS9|SP59|hK6;kallikrein-related peptidase 6;KLK6;kallikrein-related peptidase 6 |
Definition | kallikrein-6|neurosin|protease M|serine protease 18|serine protease 9|zyme |
Position | 19q13.3 |
Gene Type | protein-coding |
Source | Count: 1; Generif |
Literature support | Count: 1 PubMed records as below. |
Evidence Status |
Description |
potential | KLK6 may play a protective role against tumor progression that is likely mediated by inhibition of epithelial-to-mesenchymal transition. KLK6 may be an epigenetically regulated tumor suppressor in human breast cancer. |
More detail of all 1 literatures about KLK6 | |
Pathways and Diseases |
|
Pathway | Alpha-synuclein signaling;PID Curated;200187 |
External Links |
|
Links to Entrez Gene | 5653 |
Links to all GeneRIF Items | 5653 |
Links to iHOP | 5653 |
Sequence Information |
|
Nucleotide Sequence |
>5653 : length: 735 atgaagaagctgatggtggtgctgagtctgattgctgcagcctgggcagaggagcagaat aagttggtgcatggcggaccctgcgacaagacatctcacccctaccaagctgccctctac acctcgggccacttgctctgtggtggggtccttatccatccactgtgggtcctcacagct gcccactgcaaaaaaccgaatcttcaggtcttcctggggaagcataaccttcggcaaagg gagagttcccaggagcagagttctgttgtccgggctgtgatccaccctgactatgatgcc gccagccatgaccaggacatcatgctgttgcgcctggcacgcccagccaaactctctgaa ctcatccagccccttcccctggagagggactgctcagccaacaccaccagctgccacatc ctgggctggggcaagacagcagatggtgatttccctgacaccatccagtgtgcatacatc cacctggtgtcccgtgaggagtgtgagcatgcctaccctggccagatcacccagaacatg ttgtgtgctggggatgagaagtacgggaaggattcctgccagggtgattctgggggtccg ctggtatgtggagaccacctccgaggccttgtgtcatggggtaacatcccctgtggatca aaggagaagccaggagtctacaccaacgtctgcagatacacgaactggatccaaaaaacc attcaggccaagtga |
Protein Sequence |
>5653 : length: 244 MKKLMVVLSLIAAAWAEEQNKLVHGGPCDKTSHPYQAALYTSGHLLCGGVLIHPLWVLTA AHCKKPNLQVFLGKHNLRQRESSQEQSSVVRAVIHPDYDAASHDQDIMLLRLARPAKLSE LIQPLPLERDCSANTTSCHILGWGKTADGDFPDTIQCAYIHLVSREECEHAYPGQITQNM LCAGDEKYGKDSCQGDSGGPLVCGDHLRGLVSWGNIPCGSKEKPGVYTNVCRYTNWIQKT IQAK |
Copyright © 2016-Present - The Univsersity of Texas Health Science Center at Houston Rights Reserved |