|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 56940 |
Name | DUSP22 |
Synonym | JKAP|JSP1|LMWDSP2|MKPX|VHX;dual specificity phosphatase 22;DUSP22;dual specificity phosphatase 22 |
Definition | JNK-stimulating phosphatase 1|JNK-stimulatory phosphatase-1|JSP-1|LMW-DSP2|MAP kinase phosphatase x|MKP-x|dual specificity protein phosphatase 22|homolog of mouse dual specificity phosphatase LMW-DSP2|low molecular weight dual specificity phosphatase 2|mi |
Position | 6p25.3 |
Gene Type | protein-coding |
Source | Count: 2; TAG,Generif |
Literature support | Count: 1 PubMed records as below. |
|
Evidence Status |
Description |
potential | "This recurrent t(6;7)(p25.3;q32.3) entails a downregulation of DUSP22 and an overexpression of MIR29, leading to postulate that the first (DUSP22) might function as a tumour suppressor and the second (MIR29) as an oncogene in translocated ALK- ALCLs." |
| More detail of all 1 literatures about DUSP22 | |
|
Pathways and Diseases |
|
Pathway | Oxidative stress response;PANTHER;P00046 |
Pathway | MAPK signaling pathway;KEGG PATHWAY;hsa04010 |
Disease | Breast cancer;FunDO |
|
External Links |
|
Links to Entrez Gene | 56940 |
Links to all GeneRIF Items | 56940 |
Links to iHOP | 56940 |
|
Sequence Information |
|
Nucleotide Sequence |
>56940 : length: 555 atggggaatgggatgaacaagatcctgcccggcctgtacatcggcaacttcaaagatgcc agagacgcggaacaattgagcaagaacaaggtgacacatattctgtctgtccatgatagt gccaggcctatgttggagggagttaaatacctgtgcatcccagcagcggattcaccatct caaaacctgacaagacatttcaaagaaagtattaaattcattcacgagtgccggctccgc ggtgagagctgccttgtacactgcctggccggggtctccaggagcgtgacactggtgatc gcatacatcatgaccgtcactgactttggctgggaggatgccctgcacaccgtgcgtgct gggagatcctgtgccaaccccaacgtgggcttccagagacagctccaggagtttgagaag catgaggtccatcagtatcggcagtggctgaaggaagaatatggagagagccctttgcag gatgcagaagaagccaaaaacattctggccgctccaggaattctgaagttctgggccttt ctcagaagactgtaa |
Protein Sequence |
>56940 : length: 184 MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPS QNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRA GRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAF LRRL |