|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 6282 |
Name | S100A11 |
Synonym | MLN70|S100C;S100 calcium binding protein A11;S100A11;S100 calcium binding protein A11 |
Definition | MLN 70|S100 calcium-binding protein A11 (calgizzarin)|calgizzarin|metastatic lymph node gene 70 protein|protein S100-A11|protein S100-C |
Position | 1q21 |
Gene Type | protein-coding |
Source | Count: 1; Generif |
Literature support | Count: 1 PubMed records as below. |
|
Evidence Status |
Description |
potential | "Expression of S100A11, a putative tumor suppressor gene, is increased in the early stage of pancreatic carcinogenesis and decreased during subsequent progression to cancer." |
| More detail of all 1 literatures about S100A11 | |
|
External Links |
|
Links to Entrez Gene | 6282 |
Links to all GeneRIF Items | 6282 |
Links to iHOP | 6282 |
|
Sequence Information |
|
Nucleotide Sequence |
>6282 : length: 318 atggcaaaaatctccagccctacagagactgagcggtgcatcgagtccctgattgctgtc ttccagaagtatgctggaaaggatggttataactacactctctccaagacagagttccta agcttcatgaatacagaactagctgccttcacaaagaaccagaaggaccctggtgtcctt gaccgcatgatgaagaaactggacaccaacagtgatggtcagctagatttctcagaattt cttaatctgattggtggcctagctatggcttgccatgactccttcctcaaggctgtccct tcccagaagcggacctga |
Protein Sequence |
>6282 : length: 105 MAKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVL DRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT |