|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 6794 |
Name | STK11 |
Synonym | LKB1|PJS|hLKB1;serine/threonine kinase 11;STK11;serine/threonine kinase 11 |
Definition | liver kinase B1|polarization-related protein LKB1|renal carcinoma antigen NY-REN-19|serine/threonine-protein kinase 11|serine/threonine-protein kinase LKB1|serine/threonine-protein kinase STK11 |
Position | 19p13.3 |
Gene Type | protein-coding |
Source | Count: 3; Pubmed_search,Generif,UniProt |
Literature support | Count: 24 PubMed records as below. |
|
Evidence Status |
Description |
reviewed | LKB1 tumor suppressor protein regulates actin filament assembly through Rho and its exchange factor Dbl independently of kinase activity. |
reviewed | The LKB1/AMPK/TSC tumor suppressor axis is functional in acute myeloid leukemia. |
reviewed | "Adiponectin treatment increases the expression of tumor suppressor gene, LKB1 in breast cancer cells." |
reviewed | LKB1 serine-threonine kinase is a tumor suppressor that is inactivated in a large number of sporadic human lung non-small cell carcinomas and cervical cancers. |
reviewed | "Results place LKB1 in a coactivator role for ERalpha signaling, broadening the scientific scope of this tumor suppressor kinase and laying the groundwork for the use of LKB1 as a target for the development of new therapies against breast cancer." |
reviewed | "LKB1 is thus a major cervical tumor suppressor, demonstrating that acquired genetic alterations drive progression of HPV-induced dysplasias to invasive, lethal cancers". |
reviewed | The molecular mechanisms that underlie the tumor suppressor function of LKB1. |
reviewed | Role of LKB1 as a master regulator of polarity and metabolism could contribute to its tumor suppressor function. |
reviewed | The tumor suppressor LKB1 regulates lung cancer cell polarity by mediating cdc42 recruitment and activity. |
reviewed | High-level expression of functional tumor suppressor LKB1 in Escherichia coli. |
| More detail of all 24 literatures about STK11 | |
|
Pathways and Diseases |
|
Pathway | Adipocytokine signaling pathway;KEGG PATHWAY;hsa04920 |
Pathway | LKB1 signaling events;PID Curated;200061 |
Pathway | AMPK inhibits chREBP transcriptional activation activity;PID Reactome;500719 |
Pathway | Signaling by Insulin receptor;Reactome;REACT:498 |
Pathway | Integration of energy metabolism;Reactome;REACT:1505 |
Pathway | p53 pathway by glucose deprivation;PANTHER;P04397 |
Pathway | Activated AMPK stimulates fatty-acid oxidation in muscle;Reactome;REACT:11163 |
Pathway | Regulation of AMPK activity via LKB1;PID Reactome;500502 |
Pathway | mTOR signaling pathway;KEGG PATHWAY;hsa04150 |
Disease | Peutz-Jeghers syndrome;GAD |
Disease | Melanoma, malignant sporadic;OMIM |
Disease | Cancers;KEGG DISEASE |
Disease | Testicular tumor, sporadic;OMIM |
Disease | Pancreatic cancer;KEGG DISEASE;H00019 |
Disease | Peutz-Jegher's syndrome;GAD |
Disease | Peutz-Jeghers syndrome;OMIM |
Disease | Pancreatic cancer, sporadic;OMIM |
Disease | Cancers of the digestive system;KEGG DISEASE |
Disease | DEVELOPMENTAL;GAD |
|
External Links |
|
Links to Entrez Gene | 6794 |
Links to all GeneRIF Items | 6794 |
Links to iHOP | 6794 |
|
Sequence Information |
|
Nucleotide Sequence |
>6794 : length: 1302 atggaggtggtggacccgcagcagctgggcatgttcacggagggcgagctgatgtcggtg ggtatggacacgttcatccaccgcatcgactccaccgaggtcatctaccagccgcgccgc aagcgggccaagctcatcggcaagtacctgatgggggacctgctgggggaaggctcttac ggcaaggtgaaggaggtgctggactcggagacgctgtgcaggagggccgtcaagatcctc aagaagaagaagttgcgaaggatccccaacggggaggccaacgtgaagaaggaaattcaa ctactgaggaggttacggcacaaaaatgtcatccagctggtggatgtgttatacaacgaa gagaagcagaaaatgtatatggtgatggagtactgcgtgtgtggcatgcaggaaatgctg gacagcgtgccggagaagcgtttcccagtgtgccaggcccacgggtacttctgtcagctg attgacggcctggagtacctgcatagccagggcattgtgcacaaggacatcaagccgggg aacctgctgctcaccaccggtggcaccctcaaaatctccgacctgggcgtggccgaggca ctgcacccgttcgcggcggacgacacctgccggaccagccagggctccccggctttccag ccgcccgagattgccaacggcctggacaccttctccggcttcaaggtggacatctggtcg gctggggtcaccctctacaacatcaccacgggtctgtaccccttcgaaggggacaacatc tacaagttgtttgagaacatcgggaaggggagctacgccatcccgggcgactgtggcccc ccgctctctgacctgctgaaagggatgcttgagtacgaaccggccaagaggttctccatc cggcagatccggcagcacagctggttccggaagaaacatcctccggctgaagcaccagtg cccatcccaccgagcccagacaccaaggaccggtggcgcagcatgactgtggtgccgtac ttggaggacctgcacggcgcggacgaggacgaggacctcttcgacatcgaggatgacatc atctacactcaggacttcacggtgcccggacaggtcccagaagaggaggccagtcacaat ggacagcgccggggcctccccaaggccgtgtgtatgaacggcacagaggcggcgcagctg agcaccaaatccagggcggagggccgggcccccaaccctgcccgcaaggcctgctccgcc agcagcaagatccgccggctgtcggcctgcaagcagcagtga |
Protein Sequence |
>6794 : length: 433 MEVVDPQQLGMFTEGELMSVGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSY GKVKEVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNE EKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQAHGYFCQLIDGLEYLHSQGIVHKDIKPG NLLLTTGGTLKISDLGVAEALHPFAADDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWS AGVTLYNITTGLYPFEGDNIYKLFENIGKGSYAIPGDCGPPLSDLLKGMLEYEPAKRFSI RQIRQHSWFRKKHPPAEAPVPIPPSPDTKDRWRSMTVVPYLEDLHGADEDEDLFDIEDDI IYTQDFTVPGQVPEEEASHNGQRRGLPKAVCMNGTEAAQLSTKSRAEGRAPNPARKACSA SSKIRRLSACKQQ |