|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
Basic Information | |
|---|---|
Gene ID | 7161 |
Name | TP73 |
Synonym | P73;tumor protein p73;TP73;tumor protein p73 |
Definition | p53-like transcription factor|p53-related protein |
Position | 1p36.3 |
Gene Type | protein-coding |
Source | Count: 3; Pubmed_search,Generif,UniProt |
Literature support | Count: 19 PubMed records as below. |
Evidence Status | Description |
reviewed | The p73 tumor suppressor is targeted by Pirh2 RING finger E3 ubiquitin ligase for the proteasome-dependent degradation. |
reviewed | DNA methylation analysis of tumor suppressor genes in monoclonal gammopathy of undetermined significance. |
reviewed | Deregulated expression of E2F1 promotes proteolytic degradation of tumor suppressor p73 and inhibits its transcriptional activity. |
reviewed | acetylation status of E2F-1 contributes to the selective activation of tumor suppressor p73 gene. |
reviewed | "Data demonstrate that the long-term suppression of Plk1 increases the levels of cyclin-dependent kinase inhibitor p21(WAF1/CIP), which is partially induced by the elevated tumor suppressor p73 in p53-inactivated HeLa cells." |
reviewed | "The existence of a proapoptotic autoregulatory feedback loop between p73, YAP, and the promyelocytic leukemia (PML) tumor suppressor gene, is shown." |
reviewed | the transcriptionally active TAp73alpha tumor suppressor is implicated in the apoptosis induced by netrin-1 in a p53-independent and DCC/ubiquitin-proteasome dependent manner. |
reviewed | RASSF1A elicits apoptosis through an MST2 pathway directing proapoptotic transcription by the p73 tumor suppressor protein. |
reviewed | "p73, through HDM2, can oppose p53 tumor suppressor function and possibly contribute to tumorigenesis". |
reviewed | "Emerging evidence in this review discusses a key survival/death checkpoint in both peripheral and central neurons that involves the p53 tumor suppressor and its newly discovered family members, p73 and p63." |
| More detail of all 19 literatures about TP73 | |
Pathways and Diseases | |
Pathway | atm signaling pathway;PID BioCarta;100235 |
Pathway | E2F transcription factor network;PID Curated;200027 |
Pathway | p53 pathway;PANTHER;P00059 |
Pathway | Neurotrophin signaling pathway;KEGG PATHWAY;hsa04722 |
Pathway | Direct p53 effectors;PID Curated;200101 |
Pathway | p53 pathway by glucose deprivation;PANTHER;P04397 |
Pathway | P53 pathway feedback loops 1;PANTHER;P04392 |
Pathway | p53 pathway feedback loops 2;PANTHER;P04398 |
Pathway | p53 signaling pathway;KEGG PATHWAY;hsa04115 |
Pathway | Huntington disease;PANTHER;P00029 |
Disease | Drug abuse;FunDO |
Disease | Cancers;KEGG DISEASE |
Disease | esophageal cancer;GAD |
Disease | Fanconi's anemia;FunDO |
Disease | lung cancer;GAD |
Disease | PHARMACOGENOMIC;GAD |
Disease | breast cancer;GAD |
Disease | Hepatocellular carcinoma;KEGG DISEASE;H00048 |
Disease | head and neck cancer;GAD |
Disease | endometrial cancer;GAD |
Disease | CANCER;GAD |
Disease | Cancer;FunDO |
Disease | Cancers of the digestive system;KEGG DISEASE |
Disease | esophageal cancer gastric cardiac cancer;GAD |
Disease | Neuroblastoma;OMIM |
Disease | Leukoencephalopathy;FunDO |
External Links | |
Links to Entrez Gene | 7161 |
Links to all GeneRIF Items | 7161 |
Links to iHOP | 7161 |
Sequence Information | |
Nucleotide Sequence | >7161 : length: 1764 atgctgtacgtcggtgaccccgcacggcacctcgccacggcccagttcaatctgctgagc agcaccatggaccagatgagcagccgcgcggcctcggccagcccctacaccccagagcac gccgccagcgtgcccacccactcgccctacgcacaacccagctccaccttcgacaccatg tcgccggcgcctgtcatcccctccaacaccgactaccccggaccccaccactttgaggtc actttccagcagtccagcacggccaagtcagccacctggacgtactccccgctcttgaag aaactctactgccagatcgccaagacatgccccatccagatcaaggtgtccaccccgcca cccccaggcaccgccatccgggccatgcctgtttacaagaaagcggagcacgtgaccgac gtcgtgaaacgctgccccaaccacgagctcgggagggacttcaacgaaggacagtctgct ccagccagccacctcatccgcgtggaaggcaataatctctcgcagtatgtggatgaccct gtcaccggcaggcagagcgtcgtggtgccctatgagccaccacaggtggggacggaattc accaccatcctgtacaacttcatgtgtaacagcagctgtgtagggggcatgaaccggcgg cccatcctcatcatcatcaccctggagatgcgggatgggcaggtgctgggccgccggtcc tttgagggccgcatctgcgcctgtcctggccgcgaccgaaaagctgatgaggaccactac cgggagcagcaggccctgaacgagagctccgccaagaacggggccgccagcaagcgtgcc ttcaagcagagcccccctgccgtccccgcccttggtgccggtgtgaagaagcggcggcat ggagacgaggacacgtactaccttcaggtgcgaggccgggagaactttgagatcctgatg aagctgaaagagagcctggagctgatggagttggtgccgcagccactggtggactcctat cggcagcagcagcagctcctacagaggccgagtcacctacagcccccgtcctacgggccg gtcctctcgcccatgaacaaggtgcacgggggcatgaacaagctgccctccgtcaaccag ctggtgggccagcctcccccgcacagttcggcagctacacccaacctggggcccgtgggc cccgggatgctcaacaaccatggccacgcagtgccagccaacggcgagatgagcagcagc cacagcgcccagtccatggtctcggggtcccactgcactccgccacccccctaccacgcc gaccccagcctcgtcagttttttaacaggattggggtgtccaaactgcatcgagtatttc acctcccaagggttacagagcatttaccacctgcagaacctgaccattgaggacctgggg gccctgaagatccccgagcagtaccgcatgaccatctggcggggcctgcaggacctgaag cagggccacgactacagcaccgcgcagcagctgctccgctctagcaacgcggccaccatc tccatcggcggctcaggggaactgcagcgccagcgggtcatggaggccgtgcacttccgc gtgcgccacaccatcaccatccccaaccgcggcggcccaggcggcggccctgacgagtgg gcggacttcggcttcgacctgcccgactgcaaggcccgcaagcagcccatcaaggaggag ttcacggaggccgagatccactga |
Protein Sequence | >7161 : length: 587 MLYVGDPARHLATAQFNLLSSTMDQMSSRAASASPYTPEHAASVPTHSPYAQPSSTFDTM SPAPVIPSNTDYPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKVSTPP PPGTAIRAMPVYKKAEHVTDVVKRCPNHELGRDFNEGQSAPASHLIRVEGNNLSQYVDDP VTGRQSVVVPYEPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLEMRDGQVLGRRS FEGRICACPGRDRKADEDHYREQQALNESSAKNGAASKRAFKQSPPAVPALGAGVKKRRH GDEDTYYLQVRGRENFEILMKLKESLELMELVPQPLVDSYRQQQQLLQRPSHLQPPSYGP VLSPMNKVHGGMNKLPSVNQLVGQPPPHSSAATPNLGPVGPGMLNNHGHAVPANGEMSSS HSAQSMVSGSHCTPPPPYHADPSLVSFLTGLGCPNCIEYFTSQGLQSIYHLQNLTIEDLG ALKIPEQYRMTIWRGLQDLKQGHDYSTAQQLLRSSNAATISIGGSGELQRQRVMEAVHFR VRHTITIPNRGGPGGGPDEWADFGFDLPDCKARKQPIKEEFTEAEIH |
|
Copyright © 2016-Present - The Univsersity of Texas Health Science Center at Houston Rights Reserved |