|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 864 |
Name | RUNX3 |
Synonym | AML2|CBFA3|PEBP2aC;runt-related transcription factor 3;RUNX3;runt-related transcription factor 3 |
Definition | CBF-alpha-3|PEA2 alpha C|PEA2-alpha C|PEBP2 alpha C|PEBP2-alpha C|SL3-3 enhancer factor 1 alpha C subunit|SL3/AKV core-binding factor alpha C subunit|acute myeloid leukemia 2 protein|acute myeloid leukemia gene 2|core-binding factor subunit alpha-3|core-b |
Position | 1p36 |
Gene Type | protein-coding |
Source | Count: 3; Pubmed_search,TAG,Generif |
Literature support | Count: 13 PubMed records as below. |
|
Evidence Status |
Description |
reviewed | RUNX3 acts as a tumor suppressor in breast cancer by targeting estrogen receptor α. |
reviewed | Restored expression of the tumor suppressor gene RUNX3 reduces cancer stem cells in hepatocellular carcinoma by suppressing Jagged1-Notch signaling. |
reviewed | cyclin D1 provides a transcriptional switch that allows the tumor suppressor activity of RUNX3 to be repressed in cancer cells. |
reviewed | studies identify RUNX3 as a novel cellular target of H. pylori CagA and also reveal a mechanism by which CagA functions as an oncoprotein by blocking the activity of gastric tumor suppressor RUNX3. |
reviewed | ATBF1 associates with RUNX3 and translocates to the nucleus in response to TGF-beta signal transduction and might function in the nucleus as tumor suppressor and transcriptional regulator. |
reviewed | Regulation of RUNX3 tumor suppressor gene expression in cutaneous melanoma. |
reviewed | Clinical and experimental data support the notion that RUNX3 is a tumor suppressor in human colon cancer. |
reviewed | Hypoxic silencing of tumor suppressor RUNX3 by histone modification in gastric cancer cells. |
reviewed | Data demonstrate that RUNX3 functions as a tumor suppressor by attenuating Wnt signaling. |
reviewed | "RUNX3, a novel tumor suppressor, is frequently inactivated in gastric cancer by protein mislocalization." |
| More detail of all 13 literatures about RUNX3 | |
|
External Links |
|
Links to Entrez Gene | 864 |
Links to all GeneRIF Items | 864 |
Links to iHOP | 864 |
|
Sequence Information |
|
Nucleotide Sequence |
>864 : length: 1290 atggcatcgaacagcatcttcgactccttcccgacctactcgccgaccttcatccgcgac ccaagcaccagccgccgcttcacacctccctccccggccttcccctgcggcggcggcggc ggcaagatgggcgagaacagcggcgcgctgagcgcgcaggcggccgtggggcccggaggg cgcgcccggcccgaggtgcgctcgatggtggacgtgctggcggaccacgcaggcgagctc gtgcgcaccgacagccccaacttcctctgctccgtgctgccctcgcactggcgctgcaac aagacgctgcccgtcgccttcaaggtggtggcattgggggacgtgccggatggtacggtg gtgactgtgatggcaggcaatgacgagaactactccgctgagctgcgcaatgcctcggcc gtcatgaagaaccaggtggccaggttcaacgaccttcgcttcgtgggccgcagtgggcga gggaagagtttcaccctgaccatcactgtgttcaccaaccccacccaagtggcgacctac caccgagccatcaaggtgaccgtggacggaccccgggagcccagacggcaccggcagaag ctggaggaccagaccaagccgttccctgaccgctttggggacctggaacggctgcgcatg cgggtgacaccgagcacacccagcccccgaggctcactcagcaccacaagccacttcagc agccagccccagaccccaatccaaggcacctcggaactgaacccattctccgacccccgc cagtttgaccgctccttccccacgctgccaaccctcacggagagccgcttcccagacccc aggatgcattatcccggggccatgtcagctgccttcccctacagcgccacgccctcgggc acgagcatcagcagcctcagcgtggcgggcatgccggccaccagccgcttccaccatacc tacctcccgccaccctacccgggggccccgcagaaccagagcgggcccttccaggccaac ccgtccccctaccacctctactacgggacatcctctggctcctaccagttctccatggtg gccggcagcagcagtgggggcgaccgctcacctacccgcatgctggcctcttgcaccagc agcgctgcctctgtcgccgccggcaacctcatgaaccccagcctgggcggccagagtgat ggcgtggaggccgacggcagccacagcaactcacccacggccctgagcacgccaggccgc atggatgaggccgtgtggcggccctactga |
Protein Sequence |
>864 : length: 429 MASNSIFDSFPTYSPTFIRDPSTSRRFTPPSPAFPCGGGGGKMGENSGALSAQAAVGPGG RARPEVRSMVDVLADHAGELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGDVPDGTV VTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPTQVATY HRAIKVTVDGPREPRRHRQKLEDQTKPFPDRFGDLERLRMRVTPSTPSPRGSLSTTSHFS SQPQTPIQGTSELNPFSDPRQFDRSFPTLPTLTESRFPDPRMHYPGAMSAAFPYSATPSG TSISSLSVAGMPATSRFHHTYLPPPYPGAPQNQSGPFQANPSPYHLYYGTSSGSYQFSMV AGSSSGGDRSPTRMLASCTSSAASVAAGNLMNPSLGGQSDGVEADGSHSNSPTALSTPGR MDEAVWRPY |