|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 8772 |
Name | FADD |
Synonym | MORT1;Fas (TNFRSF6)-associated via death domain;FADD;Fas (TNFRSF6)-associated via death domain |
Definition | Fas-associating death domain-containing protein|Fas-associating protein with death domain|growth-inhibiting gene 3 protein|mediator of receptor induced toxicity|mediator of receptor-induced toxicity|protein FADD |
Position | 11q13.3 |
Gene Type | protein-coding |
Source | Count: 1; Generif |
Literature support | Count: 1 PubMed records as below. |
|
Evidence Status |
Description |
potential | "our data demonstrate that in response to taxol, Plk1 endows death-promoting and tumor-suppressor functions to its substrate, FADD". |
| More detail of all 1 literatures about FADD | |
|
Pathways and Diseases |
|
Pathway | Apoptosis;Reactome;REACT:578 |
Pathway | Activation of Pro-Caspase 8;PID Reactome;501004 |
Pathway | RIG-I-like receptor signaling pathway;KEGG PATHWAY;hsa04622 |
Pathway | TRAIL signaling pathway;PID Curated;200056 |
Pathway | induction of apoptosis through dr3 and dr4/5 death receptors;PID BioCarta;100189 |
Pathway | TNF signaling;PID Reactome;500256 |
Pathway | Death Receptor Signalling;PID Reactome;500254 |
Pathway | TNF receptor signaling pathway;PID Curated;200086 |
Pathway | Apoptosis;KEGG PATHWAY;hsa04210 |
Pathway | hiv-1 nef: negative effector of fas and tnf;PID BioCarta;100144 |
Pathway | nf-kb signaling pathway;PID BioCarta;100097 |
Pathway | FAS signaling pathway;PANTHER;P00020 |
Pathway | tnfr1 signaling pathway;PID BioCarta;100015 |
Pathway | fas signaling pathway (cd95);PID BioCarta;100167 |
Pathway | Pathways in cancer;KEGG PATHWAY;hsa05200 |
Pathway | Chagas disease;KEGG PATHWAY;hsa05142 |
Pathway | TRAIL signaling;PID Reactome;500257 |
Pathway | Toll-like receptor signaling pathway;KEGG PATHWAY;hsa04620 |
Pathway | FAS (CD95) signaling pathway;PID Curated;200067 |
Pathway | HIV-1 Nef: Negative effector of Fas and TNF-alpha;PID Curated;200133 |
Pathway | Ceramide signaling pathway;PID Curated;200100 |
Pathway | FasL/ CD95L signaling;PID Reactome;500255 |
Pathway | Apoptosis signaling pathway;PANTHER;P00006 |
Pathway | ceramide signaling pathway;PID BioCarta;100206 |
Pathway | Alzheimer's disease;KEGG PATHWAY;hsa05010 |
|
External Links |
|
Links to Entrez Gene | 8772 |
Links to all GeneRIF Items | 8772 |
Links to iHOP | 8772 |
|
Sequence Information |
|
Nucleotide Sequence |
>8772 : length: 627 atggacccgttcctggtgctgctgcactcggtgtcgtccagcctgtcgagcagcgagctg accgagctcaagttcctatgcctcgggcgcgtgggcaagcgcaagctggagcgcgtgcag agcggcctagacctcttctccatgctgctggagcagaacgacctggagcccgggcacacc gagctcctgcgcgagctgctcgcctccctgcggcgccacgacctgctgcggcgcgtcgac gacttcgaggcgggggcggcggccggggccgcgcctggggaagaagacctgtgtgcagca tttaacgtcatatgtgataatgtggggaaagattggagaaggctggctcgtcagctcaaa gtctcagacaccaagatcgacagcatcgaggacagatacccccgcaacctgacagagcgt gtgcgggagtcactgagaatctggaagaacacagagaaggagaacgcaacagtggcccac ctggtgggggctctcaggtcctgccagatgaacctggtggctgacctggtacaagaggtt cagcaggcccgtgacctccagaacaggagtggggccatgtccccgatgtcatggaactca gacgcatctacctccgaagcgtcctga |
Protein Sequence |
>8772 : length: 208 MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHT ELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLK VSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEV QQARDLQNRSGAMSPMSWNSDASTSEAS |