|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 9314 |
Name | KLF4 |
Synonym | EZF|GKLF;Kruppel-like factor 4 (gut);KLF4;Kruppel-like factor 4 (gut) |
Definition | Krueppel-like factor 4|endothelial Kruppel-like zinc finger protein|epithelial zinc finger protein EZF|gut-enriched krueppel-like factor |
Position | 9q31 |
Gene Type | protein-coding |
Source | Count: 2; Pubmed_search,Generif |
Literature support | Count: 8 PubMed records as below. |
|
Evidence Status |
Description |
potential | KLF4 is a novel candidate tumor suppressor gene in pancreatic ductal carcinoma. |
reviewed | Expression of the tumor suppressor Krüppel-like factor 4 as a prognostic predictor for colon cancer. |
reviewed | KLF4 is a tumor suppressor in B-cell non-Hodgkin lymphoma and in classic Hodgkin lymphoma. |
reviewed | Data show that that KLF4 is inactivated by either genetic or epigenetic mechanisms in a large subset of medulloblastomas and that it likely functions as a tumor suppressor gene in the pathogenesis of medulloblastoma. |
reviewed | Notch inhibits expression of the Krüppel-like factor 4 tumor suppressor in the intestinal epithelium. |
reviewed | Reduced levels of KLF4 tumor suppressor activity in colon tumors may be driven by elevated beta-catenin/Tcf signaling. |
reviewed | KLF4 is a tumor suppressor in colorectal cancer. |
potential | The work identifies KLF4 as a putative tumor suppressor in B-cell malignancies. |
| More detail of all 8 literatures about KLF4 | |
|
Pathways and Diseases |
|
Pathway | Synthesis, Secretion, and Deacylation of Ghrelin;PID Reactome;500141 |
Pathway | Regulation of Wnt-mediated beta catenin signaling and target gene transcription;PID Curated;200106 |
Disease | Alimentary system disease;FunDO |
Disease | Gastrointestinal tumor;FunDO |
Disease | Gastrointestinal cancer;FunDO |
Disease | Breast cancer;FunDO |
|
External Links |
|
Links to Entrez Gene | 9314 |
Links to all GeneRIF Items | 9314 |
Links to iHOP | 9314 |
|
Sequence Information |
|
Nucleotide Sequence |
>9314 : length: 1440 atgaggcagccacctggcgagtctgacatggctgtcagcgacgcgctgctcccatctttc tccacgttcgcgtctggcccggcgggaagggagaagacactgcgtcaagcaggtgccccg aataaccgctggcgggaggagctctcccacatgaagcgacttcccccagtgcttcccggc cgcccctatgacctggcggcggcgaccgtggccacagacctggagagcggcggagccggt gcggcttgcggcggtagcaacctggcgcccctacctcggagagagaccgaggagttcaac gatctcctggacctggactttattctctccaattcgctgacccatcctccggagtcagtg gccgccaccgtgtcctcgtcagcgtcagcctcctcttcgtcgtcgccgtcgagcagcggc cctgccagcgcgccctccacctgcagcttcacctatccgatccgggccgggaacgacccg ggcgtggcgccgggcggcacgggcggaggcctcctctatggcagggagtccgctccccct ccgacggctcccttcaacctggcggacatcaacgacgtgagcccctcgggcggcttcgtg gccgagctcctgcggccagaattggacccggtgtacattccgccgcagcagccgcagccg ccaggtggcgggctgatgggcaagttcgtgctgaaggcgtcgctgagcgcccctggcagc gagtacggcagcccgtcggtcatcagcgtcagcaaaggcagccctgacggcagccacccg gtggtggtggcgccctacaacggcgggccgccgcgcacgtgccccaagatcaagcaggag gcggtctcttcgtgcacccacttgggcgctggaccccctctcagcaatggccaccggccg gctgcacacgacttccccctggggcggcagctccccagcaggactaccccgaccctgggt cttgaggaagtgctgagcagcagggactgtcaccctgccctgccgcttcctcccggcttc catccccacccggggcccaattacccatccttcctgcccgatcagatgcagccgcaagtc ccgccgctccattaccaagagctcatgccacccggttcctgcatgccagaggagcccaag ccaaagaggggaagacgatcgtggccccggaaaaggaccgccacccacacttgtgattac gcgggctgcggcaaaacctacacaaagagttcccatctcaaggcacacctgcgaacccac acaggtgagaaaccttaccactgtgactgggacggctgtggatggaaattcgcccgctca gatgaactgaccaggcactaccgtaaacacacggggcaccgcccgttccagtgccaaaaa tgcgaccgagcattttccaggtcggaccacctcgccttacacatgaagaggcatttttaa |
Protein Sequence |
>9314 : length: 479 MRQPPGESDMAVSDALLPSFSTFASGPAGREKTLRQAGAPNNRWREELSHMKRLPPVLPG RPYDLAAATVATDLESGGAGAACGGSNLAPLPRRETEEFNDLLDLDFILSNSLTHPPESV AATVSSSASASSSSSPSSSGPASAPSTCSFTYPIRAGNDPGVAPGGTGGGLLYGRESAPP PTAPFNLADINDVSPSGGFVAELLRPELDPVYIPPQQPQPPGGGLMGKFVLKASLSAPGS EYGSPSVISVSKGSPDGSHPVVVAPYNGGPPRTCPKIKQEAVSSCTHLGAGPPLSNGHRP AAHDFPLGRQLPSRTTPTLGLEEVLSSRDCHPALPLPPGFHPHPGPNYPSFLPDQMQPQV PPLHYQELMPPGSCMPEEPKPKRGRRSWPRKRTATHTCDYAGCGKTYTKSSHLKAHLRTH TGEKPYHCDWDGCGWKFARSDELTRHYRKHTGHRPFQCQKCDRAFSRSDHLALHMKRHF |