| General information | Literature | Expression | Regulation | Variant | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 5925 |
Name | RB1 |
Synonym | OSRC|PPP1R130|RB|p105-Rb|pRb|pp110;retinoblastoma 1;RB1;retinoblastoma 1 |
Definition | prepro-retinoblastoma-associated protein|protein phosphatase 1, regulatory subunit 130|retinoblastoma suspectibility protein|retinoblastoma-associated protein |
Position | 13q14.2 |
Gene Type | protein-coding |
|
TSG scores |
Description |
| TUSON ranking | 7 |
TUSON P-value | 2.62E-66 |
| Caution | This gene might be oncogene according to our integrated oncogene list. |
|
Pathways and Diseases |
|
Pathway | influence of ras and rho proteins on g1 to s transition;PID BioCarta;100054 |
Pathway | il-2 receptor beta chain in t cell activation;PID BioCarta;100129 |
Pathway | DNA Replication;Reactome;REACT:383 |
Pathway | Phosphorylation of proteins involved in G1/S transition by active Cyclin E:Cdk2 complexes;PID Reactome;500878 |
Pathway | cyclin e destruction pathway;PID BioCarta;100166 |
Pathway | Small cell lung cancer;KEGG PATHWAY;hsa05222 |
Pathway | mechanism of gene regulation by peroxisome proliferators via ppara;PID BioCarta;100066 |
Pathway | Direct p53 effectors;PID Curated;200101 |
Pathway | regulation of transcriptional activity by pml;PID BioCarta;100067 |
Pathway | telomeres telomerase cellular aging and immortality;PID BioCarta;100021 |
Pathway | cell cycle: g1/s check point;PID BioCarta;100160 |
Pathway | FOXM1 transcription factor network;PID Curated;200120 |
Pathway | btg family proteins and cell cycle regulation;PID BioCarta;100224 |
Pathway | overview of telomerase rna component gene hterc transcriptional regulation;PID BioCarta;100020 |
Pathway | Cyclin D associated events in G1;PID Reactome;500897 |
Pathway | Pancreatic cancer;KEGG PATHWAY;hsa05212 |
Pathway | human cytomegalovirus and map kinase pathways;PID BioCarta;100149 |
Pathway | Chronic myeloid leukemia;KEGG PATHWAY;hsa05220 |
Pathway | e2f1 destruction pathway;PID BioCarta;100034 |
Pathway | hiv-1 nef: negative effector of fas and tnf;PID BioCarta;100144 |
Pathway | Inhibition of replication initiation of damaged DNA by Rb/E2F1;PID Reactome;500996 |
Pathway | tumor suppressor arf inhibits ribosomal biogenesis;PID BioCarta;100237 |
Pathway | Notch-mediated HES/HEY network;PID Curated;200196 |
Pathway | rb tumor suppressor/checkpoint signaling in response to dna damage;PID BioCarta;100046 |
Pathway | Regulation of retinoblastoma protein;PID Curated;200191 |
Pathway | E2F transcription factor network;PID Curated;200027 |
Pathway | fas signaling pathway (cd95);PID BioCarta;100167 |
Pathway | Cyclin E associated events during G1/S transition;PID Reactome;500877 |
Pathway | p53 signaling pathway;PID BioCarta;100083 |
Pathway | Prostate cancer;KEGG PATHWAY;hsa05215 |
Pathway | Cell Cycle, Mitotic;Reactome;REACT:152 |
Pathway | Non-small cell lung cancer;KEGG PATHWAY;hsa05223 |
Pathway | Cell cycle;KEGG PATHWAY;hsa04110 |
Pathway | Pathways in cancer;KEGG PATHWAY;hsa05200 |
Pathway | Bladder cancer;KEGG PATHWAY;hsa05219 |
Pathway | Melanoma;KEGG PATHWAY;hsa05218 |
Pathway | Glioma;KEGG PATHWAY;hsa05214 |
Pathway | cyclins and cell cycle regulation;PID BioCarta;100207 |
Pathway | p53 pathway feedback loops 2;PANTHER;P04398 |
Pathway | chaperones modulate interferon signaling pathway;PID BioCarta;100016 |
Pathway | regulation of p27 phosphorylation during cell cycle progression;PID BioCarta;100087 |
Disease | Cancers of the lung and pleura;KEGG DISEASE |
Disease | breast cancer;GAD |
Disease | overall effect;GAD |
Disease | Retinoblastoma;OMIM |
Disease | Cancer;FunDO |
Disease | Chronic myeloid leukemia (CML);KEGG DISEASE;H00004 |
Disease | Bladder cancer;KEGG DISEASE;H00022 |
Disease | Bladder cancer;OMIM |
Disease | Parkinson disease;FunDO |
Disease | retinoblastoma;GAD |
Disease | Eye cancer;FunDO |
Disease | Osteosarcoma;KEGG DISEASE;H00036 |
Disease | VISION;GAD |
Disease | Cancers of haematopoietic and lymphoid tissues;KEGG DISEASE |
Disease | Congenital abnormality;FunDO |
Disease | Rheumatoid arthritis;FunDO |
Disease | Cancers of the digestive system;KEGG DISEASE |
Disease | Pinealoma with bilateral retinoblastoma;OMIM |
Disease | Breast cancer;KEGG DISEASE;H00031 |
Disease | Gastritis;FunDO |
Disease | Hepatocellular carcinoma;KEGG DISEASE;H00048 |
Disease | Adenovirus infection;FunDO |
Disease | CANCER;GAD |
Disease | Osteosarcoma;GAD |
Disease | Cancers of the breast and female genital organs;KEGG DISEASE |
Disease | Endometriosis;FunDO |
Disease | Cancers of the nervous system;KEGG DISEASE |
Disease | Cancers;KEGG DISEASE |
Disease | Small cell lung cancer;KEGG DISEASE;H00013 |
Disease | Glioma;KEGG DISEASE;H00042 |
Disease | Cancers of the urinary system and male genital organs;KEGG DISEASE |
Disease | Cancers of soft tissues and bone;KEGG DISEASE |
Disease | retinoblastoma is associated;GAD |
Disease | Severe acute respiratory syndrome;FunDO |
Disease | Osteosarcoma;OMIM |
Disease | Esophageal cancer;KEGG DISEASE;H00017 |
|
External Links |
|
Links to Entrez Gene | 5925 |
Links to all GeneRIF Items | 5925 |
Links to iHOP | 5925 |
|
Sequence Information |
The sequences provided here are only the longest representative sequences, not covering all the isoforms. |
Nucleotide Sequence |
>5925 : length: 2787 atgccgcccaaaaccccccgaaaaacggccgccaccgccgccgctgccgccgcggaaccc ccggcaccgccgccgccgccccctcctgaggaggacccagagcaggacagcggcccggag gacctgcctctcgtcaggcttgagtttgaagaaacagaagaacctgattttactgcatta tgtcagaaattaaagataccagatcatgtcagagagagagcttggttaacttgggagaaa gtttcatctgtggatggagtattgggaggttatattcaaaagaaaaaggaactgtgggga atctgtatctttattgcagcagttgacctagatgagatgtcgttcacttttactgagcta cagaaaaacatagaaatcagtgtccataaattctttaacttactaaaagaaattgatacc agtaccaaagttgataatgctatgtcaagactgttgaagaagtatgatgtattgtttgca ctcttcagcaaattggaaaggacatgtgaacttatatatttgacacaacccagcagttcg atatctactgaaataaattctgcattggtgctaaaagtttcttggatcacatttttatta gctaaaggggaagtattacaaatggaagatgatctggtgatttcatttcagttaatgcta tgtgtccttgactattttattaaactctcacctcccatgttgctcaaagaaccatataaa acagctgttatacccattaatggttcacctcgaacacccaggcgaggtcagaacaggagt gcacggatagcaaaacaactagaaaatgatacaagaattattgaagttctctgtaaagaa catgaatgtaatatagatgaggtgaaaaatgtttatttcaaaaattttataccttttatg aattctcttggacttgtaacatctaatggacttccagaggttgaaaatctttctaaacga tacgaagaaatttatcttaaaaataaagatctagatgcaagattatttttggatcatgat aaaactcttcagactgattctatagacagttttgaaacacagagaacaccacgaaaaagt aaccttgatgaagaggtgaatgtaattcctccacacactccagttaggactgttatgaac actatccaacaattaatgatgattttaaattcagcaagtgatcaaccttcagaaaatctg atttcctattttaacaactgcacagtgaatccaaaagaaagtatactgaaaagagtgaag gatataggatacatctttaaagagaaatttgctaaagctgtgggacagggttgtgtcgaa attggatcacagcgatacaaacttggagttcgcttgtattaccgagtaatggaatccatg cttaaatcagaagaagaacgattatccattcaaaattttagcaaacttctgaatgacaac atttttcatatgtctttattggcgtgcgctcttgaggttgtaatggccacatatagcaga agtacatctcagaatcttgattctggaacagatttgtctttcccatggattctgaatgtg cttaatttaaaagcctttgatttttacaaagtgatcgaaagttttatcaaagcagaaggc aacttgacaagagaaatgataaaacatttagaacgatgtgaacatcgaatcatggaatcc cttgcatggctctcagattcacctttatttgatcttattaaacaatcaaaggaccgagaa ggaccaactgatcaccttgaatctgcttgtcctcttaatcttcctctccagaataatcac actgcagcagatatgtatctttctcctgtaagatctccaaagaaaaaaggttcaactacg cgtgtaaattctactgcaaatgcagagacacaagcaacctcagccttccagacccagaag ccattgaaatctacctctctttcactgttttataaaaaagtgtatcggctagcctatctc cggctaaatacactttgtgaacgccttctgtctgagcacccagaattagaacatatcatc tggacccttttccagcacaccctgcagaatgagtatgaactcatgagagacaggcatttg gaccaaattatgatgtgttccatgtatggcatatgcaaagtgaagaatatagaccttaaa ttcaaaatcattgtaacagcatacaaggatcttcctcatgctgttcaggagacattcaaa cgtgttttgatcaaagaagaggagtatgattctattatagtattctataactcggtcttc atgcagagactgaaaacaaatattttgcagtatgcttccaccaggccccctaccttgtca ccaatacctcacattcctcgaagcccttacaagtttcctagttcacccttacggattcct ggagggaacatctatatttcacccctgaagagtccatataaaatttcagaaggtctgcca acaccaacaaaaatgactccaagatcaagaatcttagtatcaattggtgaatcattcggg acttctgagaagttccagaaaataaatcagatggtatgtaacagcgaccgtgtgctcaaa agaagtgctgaaggaagcaaccctcctaaaccactgaaaaaactacgctttgatattgaa ggatcagatgaagcagatggaagtaaacatctcccaggagagtccaaatttcagcagaaa ctggcagaaatgacttctactcgaacacgaatgcaaaagcagaaaatgaatgatagcatg gatacctcaaacaaggaagagaaatga |
Protein Sequence |
>5925 : length: 928 MPPKTPRKTAATAAAAAAEPPAPPPPPPPEEDPEQDSGPEDLPLVRLEFEETEEPDFTAL CQKLKIPDHVRERAWLTWEKVSSVDGVLGGYIQKKKELWGICIFIAAVDLDEMSFTFTEL QKNIEISVHKFFNLLKEIDTSTKVDNAMSRLLKKYDVLFALFSKLERTCELIYLTQPSSS ISTEINSALVLKVSWITFLLAKGEVLQMEDDLVISFQLMLCVLDYFIKLSPPMLLKEPYK TAVIPINGSPRTPRRGQNRSARIAKQLENDTRIIEVLCKEHECNIDEVKNVYFKNFIPFM NSLGLVTSNGLPEVENLSKRYEEIYLKNKDLDARLFLDHDKTLQTDSIDSFETQRTPRKS NLDEEVNVIPPHTPVRTVMNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVK DIGYIFKEKFAKAVGQGCVEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDN IFHMSLLACALEVVMATYSRSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEG NLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKDREGPTDHLESACPLNLPLQNNH TAADMYLSPVRSPKKKGSTTRVNSTANAETQATSAFQTQKPLKSTSLSLFYKKVYRLAYL RLNTLCERLLSEHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLK FKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLS PIPHIPRSPYKFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFG TSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQK LAEMTSTRTRMQKQKMNDSMDTSNKEEK |