|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 1026 |
Name | CDKN1A |
Synonym | CAP20|CDKN1|CIP1|MDA-6|P21|SDI1|WAF1|p21CIP1;cyclin-dependent kinase inhibitor 1A (p21, Cip1);CDKN1A;cyclin-dependent kinase inhibitor 1A (p21, Cip1) |
Definition | CDK-interacting protein 1|CDK-interaction protein 1|DNA synthesis inhibitor|cyclin-dependent kinase inhibitor 1|melanoma differentiation associated protein 6|wild-type p53-activated fragment 1 |
Position | 6p21.2 |
Gene Type | protein-coding |
Source | Count: 3; Pubmed_search,TAG,Generif |
Literature support | Count: 13 PubMed records as below. |
|
Evidence Status |
Description |
reviewed | A novel tumor suppressor gene ECRG4 interacts directly with TMPRSS11A (ECRG1) to inhibit cancer cell growth in esophageal carcinoma. |
reviewed | Regulated recruitment of tumor suppressor BRCA1 to the p21 gene by coactivator methylation. |
potential | "These data demonstrate that miR-K1 represses the expression of p21, a protein with known tumor suppressor functions, and suggest that this human herpesvirus 8 miRNA is likely to contribute to the oncogenic potential of this virus." |
reviewed | Genistein induces the expression of tumor suppressor genes p21 (WAF1/CIP1/KIP1) and p16 (INK4a) with a concomitant decrease in cyclins in prostate cancer cells. |
reviewed | BAF180 is a critical regulator of p21 induction and a tumor suppressor mutated in breast cancer. |
reviewed | "PC3, but not DU145, human prostate cancer cells retain the coregulators required for tumor suppressor ability of androgen receptor." |
potential | A novel human gene encoding HECT domain and RCC1-like repeats interacts with cyclins and is potentially regulated by the tumor suppressor proteins. |
reviewed | Direct interaction of p21 cyclin-dependent kinase inhibitor with the retinoblastoma tumor suppressor protein. |
reviewed | The tumor suppressor gene Brca1 is required for embryonic cellular proliferation in the mouse. |
reviewed | Results show that that p21(Cip1) functions as a tumor suppressor in cervical carcinogenesis and that p21(Cip1) inactivation by HPV-16 E7 partially contributes to the contribution of E7 to cervical carcinogenesis. |
| More detail of all 13 literatures about CDKN1A | |
|
Pathways and Diseases |
|
Pathway | influence of ras and rho proteins on g1 to s transition;PID BioCarta;100054 |
Pathway | Class I PI3K signaling events mediated by Akt;PID Curated;200169 |
Pathway | Glucocorticoid receptor regulatory network;PID Curated;200077 |
Pathway | Direct p53 effectors;PID Curated;200101 |
Pathway | effects of calcineurin in keratinocyte differentiation;PID BioCarta;100222 |
Pathway | cell cycle: g1/s check point;PID BioCarta;100160 |
Pathway | Signaling events mediated by PRL;PID Curated;200006 |
Pathway | cell cycle: g2/m checkpoint;PID BioCarta;100159 |
Pathway | Transcriptional activation of cell cycle inhibitor p21;PID Reactome;501023 |
Pathway | Chronic myeloid leukemia;KEGG PATHWAY;hsa05220 |
Pathway | Regulation of nuclear SMAD2/3 signaling;PID Curated;200002 |
Pathway | Cyclin A:Cdk2-associated events at S phase entry;PID Reactome;500375 |
Pathway | Hepatitis C;KEGG PATHWAY;hsa05160 |
Pathway | Signalling by NGF;Reactome;REACT:11061 |
Pathway | rb tumor suppressor/checkpoint signaling in response to dna damage;PID BioCarta;100046 |
Pathway | Regulation of retinoblastoma protein;PID Curated;200191 |
Pathway | E2F transcription factor network;PID Curated;200027 |
Pathway | p53 pathway;PANTHER;P00059 |
Pathway | Signaling events mediated by HDAC Class III;PID Curated;200020 |
Pathway | hypoxia and p53 in the cardiovascular system;PID BioCarta;100084 |
Pathway | Cyclin E associated events during G1/S transition;PID Reactome;500877 |
Pathway | ErbB signaling pathway;KEGG PATHWAY;hsa04012 |
Pathway | p53 signaling pathway;PID BioCarta;100083 |
Pathway | Angiopoietin receptor Tie2-mediated signaling;PID Curated;200066 |
Pathway | Notch signaling pathway;PID Curated;200013 |
Pathway | Prostate cancer;KEGG PATHWAY;hsa05215 |
Pathway | Cell Cycle, Mitotic;Reactome;REACT:152 |
Pathway | erythropoietin mediated neuroprotection through nf-kb;PID BioCarta;100176 |
Pathway | Cell cycle;KEGG PATHWAY;hsa04110 |
Pathway | Pathways in cancer;KEGG PATHWAY;hsa05200 |
Pathway | Validated targets of C-MYC transcriptional repression;PID Curated;200171 |
Pathway | Bladder cancer;KEGG PATHWAY;hsa05219 |
Pathway | Melanoma;KEGG PATHWAY;hsa05218 |
Pathway | Glioma;KEGG PATHWAY;hsa05214 |
Pathway | cyclins and cell cycle regulation;PID BioCarta;100207 |
Pathway | Cell Cycle Checkpoints;Reactome;REACT:1538 |
Pathway | p53 pathway feedback loops 2;PANTHER;P04398 |
Pathway | p53 signaling pathway;KEGG PATHWAY;hsa04115 |
Pathway | Interleukin signaling pathway;PANTHER;P00036 |
Pathway | C-MYB transcription factor network;PID Curated;200130 |
Pathway | DNA Replication;Reactome;REACT:383 |
Disease | overall effect;GAD |
Disease | Hemolytic-Uremic syndrome;FunDO |
Disease | bladder cancer;GAD |
Disease | Cancer;FunDO |
Disease | Polyarthritis;FunDO |
Disease | Oral cancer;FunDO |
Disease | Lupus Nephritis;GAD |
Disease | Neck cancer;FunDO |
Disease | Keratosis;FunDO |
Disease | oral cancer;GAD |
Disease | Dermatitis;FunDO |
Disease | Chronic rejection of renal transplant;FunDO |
Disease | IMMUNE;GAD |
Disease | Infection;FunDO |
Disease | Rheumatoid arthritis;FunDO |
Disease | prostate cancer;GAD |
Disease | head and neck cancer;GAD |
Disease | Lupus Erythematosus, Systemic;GAD |
Disease | Sarcoidosis;FunDO |
Disease | Hyperparathyroidism;FunDO |
Disease | CANCER;GAD |
Disease | Cancers of the breast and female genital organs;KEGG DISEASE |
Disease | Endometriosis;FunDO |
Disease | Cancers;KEGG DISEASE |
Disease | Chronic simple glaucoma;FunDO |
Disease | Electrocardiographic traits;NHGRI |
Disease | Papillomavirus infection;FunDO |
Disease | Cervical cancer;KEGG DISEASE;H00030 |
Disease | breast cancer;GAD |
Disease | Metaplastic polyp;FunDO |
Disease | stomach cancer;GAD |
|
External Links |
|
Links to Entrez Gene | 1026 |
Links to all GeneRIF Items | 1026 |
Links to iHOP | 1026 |
|
Sequence Information |
|
Nucleotide Sequence |
>1026 : length: 495 atgtcagaaccggctggggatgtccgtcagaacccatgcggcagcaaggcctgccgccgc ctcttcggcccagtggacagcgagcagctgagccgcgactgtgatgcgctaatggcgggc tgcatccaggaggcccgtgagcgatggaacttcgactttgtcaccgagacaccactggag ggtgacttcgcctgggagcgtgtgcggggccttggcctgcccaagctctaccttcccacg gggccccggcgaggccgggatgagttgggaggaggcaggcggcctggcacctcacctgct ctgctgcaggggacagcagaggaagaccatgtggacctgtcactgtcttgtacccttgtg cctcgctcaggggagcaggctgaagggtccccaggtggacctggagactctcagggtcga aaacggcggcagaccagcatgacagatttctaccactccaaacgccggctgatcttctcc aagaggaagccctaa |
Protein Sequence |
>1026 : length: 164 MSEPAGDVRQNPCGSKACRRLFGPVDSEQLSRDCDALMAGCIQEARERWNFDFVTETPLE GDFAWERVRGLGLPKLYLPTGPRRGRDELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLV PRSGEQAEGSPGGPGDSQGRKRRQTSMTDFYHSKRRLIFSKRKP |