|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
Basic Information | |
|---|---|
Gene ID | 11200 |
Name | CHEK2 |
Synonym | CDS1|CHK2|HuCds1|LFS2|PP1425|RAD53|hCds1;checkpoint kinase 2;CHEK2;checkpoint kinase 2 |
Definition | CHK2 checkpoint homolog|cds1 homolog|checkpoint-like protein CHK2|protein kinase CHK2|serine/threonine-protein kinase Chk2 |
Position | 22q11|22q12.1 |
Gene Type | protein-coding |
Source | Count: 4; Pubmed_search,TAG,UniProt,Generif |
Literature support | Count: 9 PubMed records as below. |
Evidence Status | Description |
reviewed | "Recurrent loss, but lack of mutations, of the SMARCB1 tumor suppressor gene in T-cell prolymphocytic leukemia with TCL1A-TCRAD juxtaposition." |
reviewed | "Novel evidences for a tumor suppressor role of Rev3, the catalytic subunit of Pol zeta." |
reviewed | Mutations L303X & 1100delC cause a premature termination codon preventing CHEK2 & P-Thr68 CHEK2 protein expression. CHEK2 & p53 operate in the same tumor suppressor pathway.A main CHEK2 oncogenic function involves p53-mediated G1 cell-cycle arrest. |
reviewed | Fusion of the tumor-suppressor gene CHEK2 and the gene for the regulatory subunit B of protein phosphatase 2 PPP2R2A in childhood teratoma. |
reviewed | the combination of hypoxia and reoxygenation results in a G2 checkpoint response that is dependent on the tumor suppressor Chk2 and that this checkpoint response is essential for tumor cell adaptation to changes. |
reviewed | Checking in on Cds1 (Chk2): A checkpoint kinase and tumor suppressor. |
reviewed | Structural and functional versatility of the FHA domain in DNA-damage signaling by the tumor suppressor kinase Chk2. |
reviewed | DNA damage tumor suppressor genes and genomic instability. |
reviewed | Chk2 is a tumor suppressor that regulates apoptosis in both an ataxia telangiectasia mutated (ATM)-dependent and an ATM-independent manner. |
| More detail of all 9 literatures about CHEK2 | |
Pathways and Diseases | |
Pathway | Ubiquitin Mediated Degradation of Phosphorylated Cdc25A;PID Reactome;500938 |
Pathway | p53 pathway;PANTHER;P00059 |
Pathway | cell cycle: g2/m checkpoint;PID BioCarta;100159 |
Pathway | PLK3 signaling events;PID Curated;200186 |
Pathway | Cell Cycle Checkpoints;Reactome;REACT:1538 |
Pathway | role of brca1 brca2 and atr in cancer susceptibility;PID BioCarta;100234 |
Pathway | G2/M DNA damage checkpoint;PID Reactome;500952 |
Pathway | regulation of cell cycle progression by plk3;PID BioCarta;100068 |
Pathway | p53 signaling pathway;KEGG PATHWAY;hsa04115 |
Pathway | Cell cycle;KEGG PATHWAY;hsa04110 |
Pathway | FOXM1 transcription factor network;PID Curated;200120 |
Pathway | atm signaling pathway;PID BioCarta;100235 |
Pathway | p53 pathway;PID Curated;200175 |
Disease | Breast and colorectal cancer, susceptibility to;OMIM |
Disease | Vertical cup-disc ratio;NHGRI |
Disease | overall effect;GAD |
Disease | cancer;GAD |
Disease | Cancer;FunDO |
Disease | Prostate cancer, familial, susceptibility to;OMIM |
Disease | Leukoencephalopathy;FunDO |
Disease | prostate cancer;GAD |
Disease | METABOLIC;GAD |
Disease | estrogen receptor status;GAD |
Disease | upper aerodigestive tract cancer;GAD |
Disease | colorectal cancer;GAD |
Disease | diabetes, type 2;GAD |
Disease | endometrial cancer;GAD |
Disease | CANCER;GAD |
Disease | Yersinia infection;FunDO |
Disease | Li-Fraumeni syndrome;OMIM |
Disease | breast cancer;GAD |
Disease | Breast cancer, susceptibility to;OMIM |
Disease | Osteosarcoma, somatic;OMIM |
Disease | ovarian cancer;GAD |
Disease | Esophageal cancer and gastric cancer;NHGRI |
External Links | |
Links to Entrez Gene | 11200 |
Links to all GeneRIF Items | 11200 |
Links to iHOP | 11200 |
Sequence Information | |
Nucleotide Sequence | >11200 : length: 1761 atgtctcgggagtcggatgttgaggctcagcagtctcatggcagcagtgcctgttcacag ccccatggcagcgttacccagtcccaaggctcctcctcacagtcccagggcatatccagc tcctctaccagcacgatgccaaactccagccagtcctctcactccagctctgggacactg agctccttagagacagtgtccactcaggaactctattctattcctgaggaccaagaacct gaggaccaagaacctgaggagcctacccctgccccctgggctcgattatgggcccttcag gatggatttgccaatcttgagacagagtctggccatgttacccaatctgatcttgaactc ctgctgtcatctgatcctcctgcctcagcctcccaaagtgctgggataagaggtgtgagg caccatccccggccagtttgcagtctaaaatgtgtgaatgacaactactggtttgggagg gacaaaagctgtgaatattgctttgatgaaccactgctgaaaagaacagataaataccga acatacagcaagaaacactttcggattttcagggaagtgggtcctaaaaactcttacatt gcatacatagaagatcacagtggcaatggaacctttgtaaatacagagcttgtagggaaa ggaaaacgccgtcctttgaataacaattctgaaattgcactgtcactaagcagaaataaa gtttttgtcttttttgatctgactgtagatgatcagtcagtttatcctaaggcattaaga gatgaatacatcatgtcaaaaactcttggaagtggtgcctgtggagaggtaaagctggct ttcgagaggaaaacatgtaagaaagtagccataaagatcatcagcaaaaggaagtttgct attggttcagcaagagaggcagacccagctctcaatgttgaaacagaaatagaaattttg aaaaagctaaatcatccttgcatcatcaagattaaaaacttttttgatgcagaagattat tatattgttttggaattgatggaagggggagagctgtttgacaaagtggtggggaataaa cgcctgaaagaagctacctgcaagctctatttttaccagatgctcttggctgtgcagtac cttcatgaaaacggtattatacaccgtgacttaaagccagagaatgttttactgtcatct caagaagaggactgtcttataaagattactgattttgggcactccaagattttgggagag acctctctcatgagaaccttatgtggaacccccacctacttggcgcctgaagttcttgtt tctgttgggactgctgggtataaccgtgctgtggactgctggagtttaggagttattctt tttatctgccttagtgggtatccacctttctctgagcataggactcaagtgtcactgaag gatcagatcaccagtggaaaatacaacttcattcctgaagtctgggcagaagtctcagag aaagctctggaccttgtcaagaagttgttggtagtggatccaaaggcacgttttacgaca gaagaagccttaagacacccgtggcttcaggatgaagacatgaagagaaagtttcaagat cttctgtctgaggaaaatgaatccacagctctaccccaggttctagcccagccttctact agtcgaaagcggccccgtgaaggggaagccgagggtgccgagaccacaaagcgcccagct gtgtgtgctgctgtgttgtga |
Protein Sequence | >11200 : length: 586 MSRESDVEAQQSHGSSACSQPHGSVTQSQGSSSQSQGISSSSTSTMPNSSQSSHSSSGTL SSLETVSTQELYSIPEDQEPEDQEPEEPTPAPWARLWALQDGFANLETESGHVTQSDLEL LLSSDPPASASQSAGIRGVRHHPRPVCSLKCVNDNYWFGRDKSCEYCFDEPLLKRTDKYR TYSKKHFRIFREVGPKNSYIAYIEDHSGNGTFVNTELVGKGKRRPLNNNSEIALSLSRNK VFVFFDLTVDDQSVYPKALRDEYIMSKTLGSGACGEVKLAFERKTCKKVAIKIISKRKFA IGSAREADPALNVETEIEILKKLNHPCIIKIKNFFDAEDYYIVLELMEGGELFDKVVGNK RLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQEEDCLIKITDFGHSKILGE TSLMRTLCGTPTYLAPEVLVSVGTAGYNRAVDCWSLGVILFICLSGYPPFSEHRTQVSLK DQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEALRHPWLQDEDMKRKFQD LLSEENESTALPQVLAQPSTSRKRPREGEAEGAETTKRPAVCAAVL |
|
Copyright © 2016-Present - The Univsersity of Texas Health Science Center at Houston Rights Reserved |