|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
Basic Information | |
|---|---|
Gene ID | 1958 |
Name | EGR1 |
Synonym | AT225|G0S30|KROX-24|NGFI-A|TIS8|ZIF-268|ZNF225;early growth response 1;EGR1;early growth response 1 |
Definition | EGR-1|early growth response protein 1|nerve growth factor-induced protein A|transcription factor ETR103|transcription factor Zif268|zinc finger protein 225|zinc finger protein Krox-24 |
Position | 5q31.1 |
Gene Type | protein-coding |
Source | Count: 2; TAG,Generif |
Literature support | Count: 3 PubMed records as below. |
Evidence Status | Description |
potential | "Data show that miR-183 has a potential oncogenic role through the regulation of 2 tumor suppressor genes, EGR1 and PTEN, and the deregulation of this fundamental miRNA regulatory network may be central to many tumor types." |
reviewed | reveal a novel role for protein phosphatase 1 inhibitor in the regulation of the tumor suppressor gene EGR1 via activation of the MEK-ERK MAPK pathway. |
reviewed | Testing the role of Egr1 in a two-step skin carcinogenesis study revealed an accelerated development of skin tumors in Egr1-null mice. Studies reveal a new role for Egr1 as an in vivo tumor suppressor. |
| More detail of all 3 literatures about EGR1 | |
Pathways and Diseases | |
Pathway | Trk receptor signaling mediated by PI3K and PLC-gamma;PID Curated;200183 |
Pathway | Prion diseases;KEGG PATHWAY;hsa05020 |
Pathway | Calcineurin-regulated NFAT-dependent transcription in lymphocytes;PID Curated;200039 |
Pathway | Downstream signaling in naive CD8+ T cells;PID Curated;200184 |
Pathway | ErbB1 downstream signaling;PID Curated;200113 |
Pathway | Trk receptor signaling mediated by the MAPK pathway;PID Curated;200182 |
Pathway | AP-1 transcription factor network;PID Curated;200118 |
Pathway | phosphorylation of mek1 by cdk5/p35 down regulates the map kinase pathway;PID BioCarta;100210 |
Pathway | Signaling events mediated by Hepatocyte Growth Factor Receptor (c-Met);PID Curated;200032 |
Pathway | Regulation of Androgen receptor activity;PID Curated;200102 |
Pathway | Signaling events mediated by PRL;PID Curated;200006 |
Pathway | Glucocorticoid receptor regulatory network;PID Curated;200077 |
Disease | Emphysema;FunDO |
Disease | Prostate cancer;FunDO |
Disease | Infectious lung disease;FunDO |
Disease | Asthma;FunDO |
Disease | Rheumatoid arthritis;FunDO |
Disease | Congenital abnormality;FunDO |
Disease | Cancer;FunDO |
Disease | Dental plaque;FunDO |
Disease | Epilepsy;FunDO |
External Links | |
Links to Entrez Gene | 1958 |
Links to all GeneRIF Items | 1958 |
Links to iHOP | 1958 |
Sequence Information | |
Nucleotide Sequence | >1958 : length: 1632 atggccgcggccaaggccgagatgcagctgatgtccccgctgcagatctctgacccgttc ggatcctttcctcactcgcccaccatggacaactaccctaagctggaggagatgatgctg ctgagcaacggggctccccagttcctcggcgccgccggggccccagagggcagcggcagc aacagcagcagcagcagcagcgggggcggtggaggcggcgggggcggcagcaacagcagc agcagcagcagcaccttcaaccctcaggcggacacgggcgagcagccctacgagcacctg accgcagagtcttttcctgacatctctctgaacaacgagaaggtgctggtggagaccagt taccccagccaaaccactcgactgccccccatcacctatactggccgcttttccctggag cctgcacccaacagtggcaacaccttgtggcccgagcccctcttcagcttggtcagtggc ctagtgagcatgaccaacccaccggcctcctcgtcctcagcaccatctccagcggcctcc tccgcctccgcctcccagagcccacccctgagctgcgcagtgccatccaacgacagcagt cccatttactcagcggcacccaccttccccacgccgaacactgacattttccctgagcca caaagccaggccttcccgggctcggcagggacagcgctccagtacccgcctcctgcctac cctgccgccaagggtggcttccaggttcccatgatccccgactacctgtttccacagcag cagggggatctgggcctgggcaccccagaccagaagcccttccagggcctggagagccgc acccagcagccttcgctaacccctctgtctactattaaggcctttgccactcagtcgggc tcccaggacctgaaggccctcaataccagctaccagtcccagctcatcaaacccagccgc atgcgcaagtaccccaaccggcccagcaagacgcccccccacgaacgcccttacgcttgc ccagtggagtcctgtgatcgccgcttctcccgctccgacgagctcacccgccacatccgc atccacacaggccagaagcccttccagtgccgcatctgcatgcgcaacttcagccgcagc gaccacctcaccacccacatccgcacccacacaggcgaaaagcccttcgcctgcgacatc tgtggaagaaagtttgccaggagcgatgaacgcaagaggcataccaagatccacttgcgg cagaaggacaagaaagcagacaaaagtgttgtggcctcttcggccacctcctctctctct tcctacccgtccccggttgctacctcttacccgtccccggttactacctcttatccatcc ccggccaccacctcatacccatcccctgtgcccacctccttctcctctcccggctcctcg acctacccatcccctgtgcacagtggcttcccctccccgtcggtggccaccacgtactcc tctgttccccctgctttcccggcccaggtcagcagcttcccttcctcagctgtcaccaac tccttcagcgcctccacagggctttcggacatgacagcaaccttttctcccaggacaatt gaaatttgctaa |
Protein Sequence | >1958 : length: 543 MAAAKAEMQLMSPLQISDPFGSFPHSPTMDNYPKLEEMMLLSNGAPQFLGAAGAPEGSGS NSSSSSSGGGGGGGGGSNSSSSSSTFNPQADTGEQPYEHLTAESFPDISLNNEKVLVETS YPSQTTRLPPITYTGRFSLEPAPNSGNTLWPEPLFSLVSGLVSMTNPPASSSSAPSPAAS SASASQSPPLSCAVPSNDSSPIYSAAPTFPTPNTDIFPEPQSQAFPGSAGTALQYPPPAY PAAKGGFQVPMIPDYLFPQQQGDLGLGTPDQKPFQGLESRTQQPSLTPLSTIKAFATQSG SQDLKALNTSYQSQLIKPSRMRKYPNRPSKTPPHERPYACPVESCDRRFSRSDELTRHIR IHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR QKDKKADKSVVASSATSSLSSYPSPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSS TYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTI EIC |
|
Copyright © 2016-Present - The Univsersity of Texas Health Science Center at Houston Rights Reserved |