|
||
|
||
General information | Expression | Regulation | Mutation | Interaction |
Basic Information |
|
---|---|
Gene ID | 4089 |
Name | SMAD4 |
Synonym | DPC4|JIP|MADH4;SMAD family member 4;SMAD4;SMAD family member 4 |
Definition | MAD homolog 4|SMAD, mothers against DPP homolog 4|deleted in pancreatic carcinoma locus 4|deletion target in pancreatic carcinoma 4|mothers against decapentaplegic homolog 4|mothers against decapentaplegic, Drosophila, homolog of, 4 |
Position | 18q21.1 |
Gene Type | protein-coding |
Source | Count: 3; Pubmed_search,TAG,Generif |
Literature support | Count: 23 PubMed records as below. |
Evidence Status |
Description |
reviewed | Dual role of the Smad4/DPC4 tumor suppressor in TGFbeta-inducible transcriptional complexes. |
potential | "DPC4, a candidate tumor suppressor gene at human chromosome 18q21.1." |
reviewed | A restricted spectrum of mutations in the SMAD4 tumor-suppressor gene underlies Myhre syndrome. |
potential | "Aberrant TGFβ/SMAD4 signaling contributes to epigenetic silencing of a putative tumor suppressor, RunX1T1 in ovarian cancer." |
reviewed | Results define a molecular mechanism that explains how loss of the tumor suppressor Smad4 promotes colorectal cancer progression. |
reviewed | combined with screening of K-ras mutations and allelic losses of tumor suppressors p16 and DPC4 represents a very sensitive approach in screening for pancreatic malignancy. |
reviewed | Inactivation of SMAD4 tumor suppressor gene during gastric carcinoma progression. |
reviewed | These data define the expression control of an essential BM component as a novel function for the tumor suppressor Smad4. |
reviewed | Breast cancer bone metastasis mediated by the Smad tumor suppressor pathway. |
reviewed | Degradation of the tumor suppressor Smad4 by WW and HECT domain ubiquitin ligases. |
More detail of all 23 literatures about SMAD4 | |
Pathways and Diseases |
|
Pathway | Signaling by BMP;PID Reactome;500592 |
Pathway | nfkb activation by nontypeable hemophilus influenzae;PID BioCarta;100088 |
Pathway | alk in cardiac myocytes;PID BioCarta;100244 |
Pathway | HIF-1-alpha transcription factor network;PID Curated;200172 |
Pathway | ALK1 signaling events;PID Curated;200126 |
Pathway | TGF-beta signaling pathway;PANTHER;P00052 |
Pathway | tgf beta signaling pathway;PID BioCarta;100017 |
Pathway | cell cycle: g1/s check point;PID BioCarta;100160 |
Pathway | Pancreatic cancer;KEGG PATHWAY;hsa05212 |
Pathway | Wnt signaling pathway;KEGG PATHWAY;hsa04310 |
Pathway | BMP receptor signaling;PID Curated;200123 |
Pathway | Chronic myeloid leukemia;KEGG PATHWAY;hsa05220 |
Pathway | TGF-beta receptor signaling;PID Curated;200195 |
Pathway | Regulation of nuclear SMAD2/3 signaling;PID Curated;200002 |
Pathway | BMP Signalling Pathway;BioCyc;PWY66-11 |
Pathway | Validated targets of C-MYC transcriptional repression;PID Curated;200171 |
Pathway | Validated targets of C-MYC transcriptional activation;PID Curated;200045 |
Pathway | Colorectal cancer;KEGG PATHWAY;hsa05210 |
Pathway | ctcf: first multivalent nuclear factor;PID BioCarta;100194 |
Pathway | LKB1 signaling events;PID Curated;200061 |
Pathway | Adherens junction;KEGG PATHWAY;hsa04520 |
Pathway | Wnt signaling pathway;PANTHER;P00057 |
Pathway | wnt signaling pathway;PID BioCarta;100002 |
Pathway | Signaling by BMP;Reactome;REACT:12034 |
Pathway | TGF-beta signaling pathway;KEGG PATHWAY;hsa04350 |
Pathway | Cell cycle;KEGG PATHWAY;hsa04110 |
Pathway | Pathways in cancer;KEGG PATHWAY;hsa05200 |
Pathway | Signaling by TGF beta;PID Reactome;500590 |
Pathway | ALK2 signaling events;PID Curated;200138 |
Pathway | Regulation of cytoplasmic and nuclear SMAD2/3 signaling;PID Curated;200152 |
Pathway | Signaling by TGF beta;Reactome;REACT:6844 |
Disease | Colorectal cancer;KEGG DISEASE;H00020 |
Disease | Capillaries disease;FunDO |
Disease | Cancers;KEGG DISEASE |
Disease | polyposis, gastric;GAD |
Disease | Pancreatic cancer;KEGG DISEASE;H00019 |
Disease | Juvenile polyposis/hereditary hemorrhagic telangiectasia syndrome;OMIM |
Disease | Pancreatic cancer;OMIM |
Disease | polyposis, juvenile;GAD |
Disease | Cancer;FunDO |
Disease | Cancers of the digestive system;KEGG DISEASE |
Disease | juvenile polyposis syndrome;GAD |
Disease | Polyposis, juvenile intestinal;OMIM |
Disease | Vascular disease;FunDO |
External Links |
|
Links to Entrez Gene | 4089 |
Links to all GeneRIF Items | 4089 |
Links to iHOP | 4089 |
Sequence Information |
|
Nucleotide Sequence |
>4089 : length: 1659 atggacaatatgtctattacgaatacaccaacaagtaatgatgcctgtctgagcattgtg catagtttgatgtgccatagacaaggtggagagagtgaaacatttgcaaaaagagcaatt gaaagtttggtaaagaagctgaaggagaaaaaagatgaattggattctttaataacagct ataactacaaatggagctcatcctagtaaatgtgttaccatacagagaacattggatggg aggcttcaggtggctggtcggaaaggatttcctcatgtgatctatgcccgtctctggagg tggcctgatcttcacaaaaatgaactaaaacatgttaaatattgtcagtatgcgtttgac ttaaaatgtgatagtgtctgtgtgaatccatatcactacgaacgagttgtatcacctgga attgatctctcaggattaacactgcagagtaatgctccatcaagtatgatggtgaaggat gaatatgtgcatgactttgagggacagccatcgttgtccactgaaggacattcaattcaa accatccagcatccaccaagtaatcgtgcatcgacagagacatacagcaccccagctctg ttagccccatctgagtctaatgctaccagcactgccaactttcccaacattcctgtggct tccacaagtcagcctgccagtatactggggggcagccatagtgaaggactgttgcagata gcatcagggcctcagccaggacagcagcagaatggatttactggtcagccagctacttac catcataacagcactaccacctggactggaagtaggactgcaccatacacacctaatttg cctcaccaccaaaacggccatcttcagcaccacccgcctatgccgccccatcccggacat tactggcctgttcacaatgagcttgcattccagcctcccatttccaatcatcctgctcct gagtattggtgttccattgcttactttgaaatggatgttcaggtaggagagacatttaag gttccttcaagctgccctattgttactgttgatggatacgtggacccttctggaggagat cgcttttgtttgggtcaactctccaatgtccacaggacagaagccattgagagagcaagg ttgcacataggcaaaggtgtgcagttggaatgtaaaggtgaaggtgatgtttgggtcagg tgccttagtgaccacgcggtctttgtacagagttactacttagacagagaagctgggcgt gcacctggagatgctgttcataagatctacccaagtgcatatataaaggtctttgatttg cgtcagtgtcatcgacagatgcagcagcaggcggctactgcacaagctgcagcagctgcc caggcagcagccgtggcaggaaacatccctggcccaggatcagtaggtggaatagctcca gctatcagtctgtcagctgctgctggaattggtgttgatgaccttcgtcgcttatgcata ctcaggatgagttttgtgaaaggctggggaccggattacccaagacagagcatcaaagaa acaccttgctggattgaaattcacttacaccgggccctccagctcctagacgaagtactt cataccatgccgattgcagacccacaacctttagactga |
Protein Sequence |
>4089 : length: 552 MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITA ITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFD LKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPSSMMVKDEYVHDFEGQPSLSTEGHSIQ TIQHPPSNRASTETYSTPALLAPSESNATSTANFPNIPVASTSQPASILGGSHSEGLLQI ASGPQPGQQQNGFTGQPATYHHNSTTTWTGSRTAPYTPNLPHHQNGHLQHHPPMPPHPGH YWPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGD RFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGR APGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAP AISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVL HTMPIADPQPLD |
Copyright © 2016-Present - The Univsersity of Texas Health Science Center at Houston Rights Reserved |