| 
     | 
    ||
| 
     | 
    
    ||
| General information | Expression | Regulation | Mutation | Interaction | 
Basic Information  |  |
|---|---|
Gene ID  |  4089  | 
Name  |  SMAD4  | 
Synonym  |  DPC4|JIP|MADH4;SMAD family member 4;SMAD4;SMAD family member 4  | 
Definition  |  MAD homolog 4|SMAD, mothers against DPP homolog 4|deleted in pancreatic carcinoma locus 4|deletion target in pancreatic carcinoma 4|mothers against decapentaplegic homolog 4|mothers against decapentaplegic, Drosophila, homolog of, 4  | 
Position  |  18q21.1  | 
Gene Type  |  protein-coding  | 
Source  |  Count: 3; Pubmed_search,TAG,Generif  | 
Literature support  |  Count: 23 PubMed records as below.  | 
Evidence Status  |  Description  | 
reviewed  |  Dual role of the Smad4/DPC4 tumor suppressor in TGFbeta-inducible transcriptional complexes. | 
potential  |  "DPC4, a candidate tumor suppressor gene at human chromosome 18q21.1." | 
reviewed  |  A restricted spectrum of mutations in the SMAD4 tumor-suppressor gene underlies Myhre syndrome. | 
potential  |  "Aberrant TGFβ/SMAD4 signaling contributes to epigenetic silencing of a putative tumor suppressor, RunX1T1 in ovarian cancer." | 
reviewed  |  Results define a molecular mechanism that explains how loss of the tumor suppressor Smad4 promotes colorectal cancer progression. | 
reviewed  |  combined with screening of K-ras mutations and allelic losses of tumor suppressors p16 and DPC4 represents a very sensitive approach in screening for pancreatic malignancy. | 
reviewed  |  Inactivation of SMAD4 tumor suppressor gene during gastric carcinoma progression. | 
reviewed  |  These data define the expression control of an essential BM component as a novel function for the tumor suppressor Smad4. | 
reviewed  |  Breast cancer bone metastasis mediated by the Smad tumor suppressor pathway. | 
reviewed  |  Degradation of the tumor suppressor Smad4 by WW and HECT domain ubiquitin ligases. | 
| More detail of all 23 literatures about SMAD4 | |
Pathways and Diseases  |  |
Pathway  |  Signaling by BMP;PID Reactome;500592  | 
Pathway  |  nfkb activation by nontypeable hemophilus influenzae;PID BioCarta;100088  | 
Pathway  |  alk in cardiac myocytes;PID BioCarta;100244  | 
Pathway  |  HIF-1-alpha transcription factor network;PID Curated;200172  | 
Pathway  |  ALK1 signaling events;PID Curated;200126  | 
Pathway  |  TGF-beta signaling pathway;PANTHER;P00052  | 
Pathway  |  tgf beta signaling pathway;PID BioCarta;100017  | 
Pathway  |  cell cycle: g1/s check point;PID BioCarta;100160  | 
Pathway  |  Pancreatic cancer;KEGG PATHWAY;hsa05212  | 
Pathway  |  Wnt signaling pathway;KEGG PATHWAY;hsa04310  | 
Pathway  |  BMP receptor signaling;PID Curated;200123  | 
Pathway  |  Chronic myeloid leukemia;KEGG PATHWAY;hsa05220  | 
Pathway  |  TGF-beta receptor signaling;PID Curated;200195  | 
Pathway  |  Regulation of nuclear SMAD2/3 signaling;PID Curated;200002  | 
Pathway  |  BMP Signalling Pathway;BioCyc;PWY66-11  | 
Pathway  |  Validated targets of C-MYC transcriptional repression;PID Curated;200171  | 
Pathway  |  Validated targets of C-MYC transcriptional activation;PID Curated;200045  | 
Pathway  |  Colorectal cancer;KEGG PATHWAY;hsa05210  | 
Pathway  |  ctcf: first multivalent nuclear factor;PID BioCarta;100194  | 
Pathway  |  LKB1 signaling events;PID Curated;200061  | 
Pathway  |  Adherens junction;KEGG PATHWAY;hsa04520  | 
Pathway  |  Wnt signaling pathway;PANTHER;P00057  | 
Pathway  |  wnt signaling pathway;PID BioCarta;100002  | 
Pathway  |  Signaling by BMP;Reactome;REACT:12034  | 
Pathway  |  TGF-beta signaling pathway;KEGG PATHWAY;hsa04350  | 
Pathway  |  Cell cycle;KEGG PATHWAY;hsa04110  | 
Pathway  |  Pathways in cancer;KEGG PATHWAY;hsa05200  | 
Pathway  |  Signaling by TGF beta;PID Reactome;500590  | 
Pathway  |  ALK2 signaling events;PID Curated;200138  | 
Pathway  |  Regulation of cytoplasmic and nuclear SMAD2/3 signaling;PID Curated;200152  | 
Pathway  |  Signaling by TGF beta;Reactome;REACT:6844  | 
Disease  |  Colorectal cancer;KEGG DISEASE;H00020  | 
Disease  |  Capillaries disease;FunDO  | 
Disease  |  Cancers;KEGG DISEASE  | 
Disease  |  polyposis, gastric;GAD  | 
Disease  |  Pancreatic cancer;KEGG DISEASE;H00019  | 
Disease  |  Juvenile polyposis/hereditary hemorrhagic telangiectasia syndrome;OMIM  | 
Disease  |  Pancreatic cancer;OMIM  | 
Disease  |  polyposis, juvenile;GAD  | 
Disease  |  Cancer;FunDO  | 
Disease  |  Cancers of the digestive system;KEGG DISEASE  | 
Disease  |  juvenile polyposis syndrome;GAD  | 
Disease  |  Polyposis, juvenile intestinal;OMIM  | 
Disease  |  Vascular disease;FunDO  | 
External Links  |  |
Links to Entrez Gene  |  4089 | 
Links to all GeneRIF Items  |  4089 | 
Links to iHOP  |  4089 | 
Sequence Information  |  |
Nucleotide Sequence  |  >4089 : length: 1659 atggacaatatgtctattacgaatacaccaacaagtaatgatgcctgtctgagcattgtg catagtttgatgtgccatagacaaggtggagagagtgaaacatttgcaaaaagagcaatt gaaagtttggtaaagaagctgaaggagaaaaaagatgaattggattctttaataacagct ataactacaaatggagctcatcctagtaaatgtgttaccatacagagaacattggatggg aggcttcaggtggctggtcggaaaggatttcctcatgtgatctatgcccgtctctggagg tggcctgatcttcacaaaaatgaactaaaacatgttaaatattgtcagtatgcgtttgac ttaaaatgtgatagtgtctgtgtgaatccatatcactacgaacgagttgtatcacctgga attgatctctcaggattaacactgcagagtaatgctccatcaagtatgatggtgaaggat gaatatgtgcatgactttgagggacagccatcgttgtccactgaaggacattcaattcaa accatccagcatccaccaagtaatcgtgcatcgacagagacatacagcaccccagctctg ttagccccatctgagtctaatgctaccagcactgccaactttcccaacattcctgtggct tccacaagtcagcctgccagtatactggggggcagccatagtgaaggactgttgcagata gcatcagggcctcagccaggacagcagcagaatggatttactggtcagccagctacttac catcataacagcactaccacctggactggaagtaggactgcaccatacacacctaatttg cctcaccaccaaaacggccatcttcagcaccacccgcctatgccgccccatcccggacat tactggcctgttcacaatgagcttgcattccagcctcccatttccaatcatcctgctcct gagtattggtgttccattgcttactttgaaatggatgttcaggtaggagagacatttaag gttccttcaagctgccctattgttactgttgatggatacgtggacccttctggaggagat cgcttttgtttgggtcaactctccaatgtccacaggacagaagccattgagagagcaagg ttgcacataggcaaaggtgtgcagttggaatgtaaaggtgaaggtgatgtttgggtcagg tgccttagtgaccacgcggtctttgtacagagttactacttagacagagaagctgggcgt gcacctggagatgctgttcataagatctacccaagtgcatatataaaggtctttgatttg cgtcagtgtcatcgacagatgcagcagcaggcggctactgcacaagctgcagcagctgcc caggcagcagccgtggcaggaaacatccctggcccaggatcagtaggtggaatagctcca gctatcagtctgtcagctgctgctggaattggtgttgatgaccttcgtcgcttatgcata ctcaggatgagttttgtgaaaggctggggaccggattacccaagacagagcatcaaagaa acaccttgctggattgaaattcacttacaccgggccctccagctcctagacgaagtactt cataccatgccgattgcagacccacaacctttagactga  | 
Protein Sequence  |  >4089 : length: 552 MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITA ITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFD LKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPSSMMVKDEYVHDFEGQPSLSTEGHSIQ TIQHPPSNRASTETYSTPALLAPSESNATSTANFPNIPVASTSQPASILGGSHSEGLLQI ASGPQPGQQQNGFTGQPATYHHNSTTTWTGSRTAPYTPNLPHHQNGHLQHHPPMPPHPGH YWPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGD RFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGR APGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAP AISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVL HTMPIADPQPLD  | 
| 
             Copyright © 2016-Present - The Univsersity of Texas Health Science Center at Houston                                                 Rights Reserved  |