|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 5071 |
Name | PARK2 |
Synonym | AR-JP|LPRS2|PDJ|PRKN;parkinson protein 2, E3 ubiquitin protein ligase (parkin);PARK2;parkinson protein 2, E3 ubiquitin protein ligase (parkin) |
Definition | E3 ubiquitin ligase|E3 ubiquitin-protein ligase parkin|Parkinson disease (autosomal recessive, juvenile) 2, parkin|parkin 2|parkinson disease protein 2|parkinson juvenile disease protein 2 |
Position | 6q25.2-q27 |
Gene Type | protein-coding |
Source | Count: 2; Pubmed_search,Generif |
Literature support | Count: 7 PubMed records as below. |
|
Evidence Status |
Description |
reviewed | Parkin as a tumor suppressor gene for hepatocellular carcinoma. |
reviewed | Parkin is a tumor suppressor gene whose inactivation may play an important role in non-small cell lung cancer tumorigenesis. |
reviewed | "Allelic loss of 6q25-27, the PARKIN tumor suppressor gene locus, in cervical carcinoma." |
reviewed | Data strongly point to PARK2 as a tumor suppressor on 6q25.2-q27. |
potential | "candidate tumor suppressor genes PARK2 and PACRG are epigenetically regulated in human leukemia, suggesting that abnormal methylation and regulation of PARK2 and PACRG may play a role in the pathogenesis and development of this hematological neoplasm". |
potential | analysis of Parkin protein expression with antibodies revealed that most of the ovarian cancer cell lines and primary tumors had diminished or absent Parkin expression and it is suggested it may be a tumor suppressor gene. |
potential | "Parkin, implicated in autosomal recessive juvenile parkinsonism, is a candidate tumor suppressor gene on chromosome 6q25-q27 in breast asnd ovarian cancers." |
| More detail of all 7 literatures about PARK2 | |
|
Pathways and Diseases |
|
Pathway | alpha-synuclein and parkin-mediated proteolysis in parkinson`s disease;PID BioCarta;100080 |
Pathway | Parkinson disease;PANTHER;P00049 |
Pathway | Ubiquitin mediated proteolysis;KEGG PATHWAY;hsa04120 |
Pathway | role of parkin in ubiquitin-proteasomal pathway;PID BioCarta;100081 |
Pathway | Alpha-synuclein signaling;PID Curated;200187 |
Pathway | Protein processing in endoplasmic reticulum;KEGG PATHWAY;hsa04141 |
Pathway | Parkinson's disease;KEGG PATHWAY;hsa05012 |
Disease | Primary tumor;FunDO |
Disease | Serum metabolites;NHGRI |
Disease | Pancreatic cancer;NHGRI |
Disease | Nervous system diseases;KEGG DISEASE |
Disease | Breast cancer;FunDO |
Disease | Liver cancer;FunDO |
Disease | Leprosy, susceptibility to;OMIM |
Disease | Leprosy;FunDO |
Disease | Parkinson's disease;GAD |
Disease | Leprosy;GAD |
Disease | serum metabolites;GAD |
Disease | Leukemia;FunDO |
Disease | METABOLIC;GAD |
Disease | INFECTION;GAD |
Disease | Adenocarcinoma of lung, somatic;OMIM |
Disease | Tuberculosis;FunDO |
Disease | Adenocarcinoma, ovarian, somatic;OMIM |
Disease | Movement disorder;FunDO |
Disease | CNS metastases;FunDO |
Disease | NEUROLOGICAL;GAD |
Disease | Parkinson's disease;KEGG DISEASE;H00057 |
Disease | Parkinson disease, juvenile, type 2;OMIM |
Disease | Ovarian cancer;FunDO |
Disease | Congenital abnormality;FunDO |
Disease | Neurodegenerative diseases;KEGG DISEASE |
|
External Links |
|
Links to Entrez Gene | 5071 |
Links to all GeneRIF Items | 5071 |
Links to iHOP | 5071 |
|
Sequence Information |
|
Nucleotide Sequence |
>5071 : length: 1398 atgatagtgtttgtcaggttcaactccagccatggtttcccagtggaggtcgattctgac accagcatcttccagctcaaggaggtggttgctaagcgacagggggttccggctgaccag ttgcgtgtgattttcgcagggaaggagctgaggaatgactggactgtgcagaattgtgac ctggatcagcagagcattgttcacattgtgcagagaccgtggagaaaaggtcaagaaatg aatgcaactggaggcgacgaccccagaaacgcggcgggaggctgtgagcgggagccccag agcttgactcgggtggacctcagcagctcagtcctcccaggagactctgtggggctggct gtcattctgcacactgacagcaggaaggactcaccaccagctggaagtccagcaggtaga tcaatctacaacagcttttatgtgtattgcaaaggcccctgtcaaagagtgcagccggga aaactcagggtacagtgcagcacctgcaggcaggcaacgctcaccttgacccagggtcca tcttgctgggatgatgttttaattccaaaccggatgagtggtgaatgccaatccccacac tgccctgggactagtgcagaatttttctttaaatgtggagcacaccccacctctgacaag gaaacatcagtagctttgcacctgatcgcaacaaatagtcggaacatcacttgcattacg tgcacagacgtcaggagccccgtcctggttttccagtgcaactcccgccacgtgatttgc ttagactgtttccacttatactgtgtgacaagactcaatgatcggcagtttgttcacgac cctcaacttggctactccctgccttgtgtggctggctgtcccaactccttgattaaagag ctccatcacttcaggattctgggagaagagcagtacaaccggtaccagcagtatggtgca gaggagtgtgtcctgcagatggggggcgtgttatgcccccgccctggctgtggagcgggg ctgctgccggagcctgaccagaggaaagtcacctgcgaagggggcaatggcctgggctgt gggtttgccttctgccgggaatgtaaagaagcgtaccatgaaggggagtgcagtgccgta tttgaagcctcaggaacaactactcaggcctacagagtcgatgaaagagccgccgagcag gctcgttgggaagcagcctccaaagaaaccatcaagaaaaccaccaagccctgtccccgc tgccatgtaccagtggaaaaaaatggaggctgcatgcacatgaagtgtccgcagccccag tgcaggctcgagtggtgctggaactgtggctgcgagtggaaccgcgtctgcatgggggac cactggttcgacgtgtag |
Protein Sequence |
>5071 : length: 465 MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCD LDQQSIVHIVQRPWRKGQEMNATGGDDPRNAAGGCEREPQSLTRVDLSSSVLPGDSVGLA VILHTDSRKDSPPAGSPAGRSIYNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQGP SCWDDVLIPNRMSGECQSPHCPGTSAEFFFKCGAHPTSDKETSVALHLIATNSRNITCIT CTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLNDRQFVHDPQLGYSLPCVAGCPNSLIKE LHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGC GFAFCRECKEAYHEGECSAVFEASGTTTQAYRVDERAAEQARWEAASKETIKKTTKPCPR CHVPVEKNGGCMHMKCPQPQCRLEWCWNCGCEWNRVCMGDHWFDV |