|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
Basic Information | |
|---|---|
Gene ID | 7490 |
Name | WT1 |
Synonym | AWT1|EWS-WT1|GUD|NPHS4|WAGR|WIT-2|WT33;Wilms tumor 1;WT1;Wilms tumor 1 |
Definition | Wilms tumor protein|amino-terminal domain of EWS|last three zinc fingers of the DNA-binding domain of WT1 |
Position | 11p13 |
Gene Type | protein-coding |
Source | Count: 3; Pubmed_search,Generif,UniProt |
Literature support | Count: 68 PubMed records as below. |
Evidence Status | Description |
reviewed | Induction of Rb-associated protein (RbAp46) by Wilms' tumor suppressor WT1 mediates growth inhibition. |
reviewed | Ciao 1 is a novel WD40 protein that interacts with the tumor suppressor protein WT1. |
reviewed | Inhibition of cellular proliferation by the Wilms tumor suppressor WT1 requires association with the inducible chaperone Hsp70. |
reviewed | "A novel mutation H373Y in the Wilms' tumor suppressor gene, WT1, associated with Denys-Drash syndrome." |
reviewed | "A novel repressor, par-4, modulates transcription and growth suppression functions of the Wilms' tumor suppressor WT1." |
reviewed | The WT1 Wilms tumor gene product: a developmentally regulated transcription factor in the kidney that functions as a tumor suppressor. |
reviewed | The Wilms' tumor suppressor gene WT1 is negatively autoregulated. |
reviewed | Regulation of the proto-oncogenes bcl-2 and c-myc by the Wilms' tumor suppressor gene WT1. |
reviewed | "Analysis of the Wilms' tumor suppressor gene (WT1) in patients 46,XY disorders of sex development." |
reviewed | tumor suppressor menin represses paired box gene 2 expression via Wilms tumor suppressor protein-polycomb group complex. |
| More detail of all 68 literatures about WT1 | |
Pathways and Diseases | |
Pathway | chaperones modulate interferon signaling pathway;PID BioCarta;100016 |
Pathway | overview of telomerase protein component gene htert transcriptional regulation;PID BioCarta;100019 |
Pathway | Regulation of Telomerase;PID Curated;200072 |
Disease | Denys-Drash syndrome;GAD |
Disease | Nephrotic syndrome, typ 4;OMIM |
Disease | Alzheimer's disease;GAD |
Disease | Cancer;FunDO |
Disease | WAGR Syndrome;GAD |
Disease | DEVELOPMENTAL;GAD |
Disease | glomerulosclerosis, focal;GAD |
Disease | Pleural effusion, Malignant;FunDO |
Disease | Meacham syndrome;OMIM |
Disease | Frasier syndrome;OMIM |
Disease | Wilm's tumor;GAD |
Disease | Aplastic anemia;FunDO |
Disease | Yersinia infection;FunDO |
Disease | Cirrhosis;FunDO |
Disease | Alzheimer's disease;FunDO |
Disease | wilms' tumor and congenital male genitourinary malformation;GAD |
Disease | Nephritis;FunDO |
Disease | Proteinuria;FunDO |
Disease | Wilms tumor, type 1;OMIM |
Disease | CANCER;GAD |
Disease | hypospadias;GAD |
Disease | Endometriosis;FunDO |
Disease | NEUROLOGICAL;GAD |
Disease | abnormal urogenital development;GAD |
Disease | Hyperparathyroidism;FunDO |
Disease | nephrotic syndrome;GAD |
Disease | Urogenital abnormalities;FunDO |
Disease | Denys-Drash syndrome;OMIM |
Disease | RENAL;GAD |
External Links | |
Links to Entrez Gene | 7490 |
Links to all GeneRIF Items | 7490 |
Links to iHOP | 7490 |
Sequence Information | |
Nucleotide Sequence | >7490 : length: 1494 ctgcaggacccggcttccacgtgtgtcccggagccggcgtctcagcacacgctccgctcc gggcctgggtgcctacagcagccagagcagcagggagtccgggacccgggcggcatctgg gccaagttaggcgccgccgaggccagcgctgaacgtctccagggccggaggagccgcggg gcgtccgggtctgagccgcagcaaatgggctccgacgtgcgggacctgaacgcgctgctg cccgccgtcccctccctgggtggcggcggcggctgtgccctgcctgtgagcggcgcggcg cagtgggcgccggtgctggactttgcgcccccgggcgcttcggcttacgggtcgttgggc ggccccgcgccgccaccggctccgccgccacccccgccgccgccgcctcactccttcatc aaacaggagccgagctggggcggcgcggagccgcacgaggagcagtgcctgagcgccttc actgtccacttttccggccagttcactggcacagccggagcctgtcgctacgggcccttc ggtcctcctccgcccagccaggcgtcatccggccaggccaggatgtttcctaacgcgccc tacctgcccagctgcctcgagagccagcccgctattcgcaatcagggttacagcacggtc accttcgacgggacgcccagctacggtcacacgccctcgcaccatgcggcgcagttcccc aaccactcattcaagcatgaggatcccatgggccagcagggctcgctgggtgagcagcag tactcggtgccgcccccggtctatggctgccacacccccaccgacagctgcaccggcagc caggctttgctgctgaggacgccctacagcagtgacaatttataccaaatgacatcccag cttgaatgcatgacctggaatcagatgaacttaggagccaccttaaagggccacagcaca gggtacgagagcgataaccacacaacgcccatcctctgcggagcccaatacagaatacac acgcacggtgtcttcagaggcattcaggatgtgcgacgtgtgcctggagtagccccgact cttgtacggtcggcatctgagaccagtgagaaacgccccttcatgtgtgcttacccaggc tgcaataagagatattttaagctgtcccacttacagatgcacagcaggaagcacactggt gagaaaccataccagtgtgacttcaaggactgtgaacgaaggttttctcgttcagaccag ctcaaaagacaccaaaggagacatacaggtgtgaaaccattccagtgtaaaacttgtcag cgaaagttctcccggtccgaccacctgaagacccacaccaggactcatacaggtgaaaag cccttcagctgtcggtggccaagttgtcagaaaaagtttgcccggtcagatgaattagtc cgccatcacaacatgcatcagagaaacatgaccaaactccagctggcgctttga |
Protein Sequence | >7490 : length: 497 MQDPASTCVPEPASQHTLRSGPGCLQQPEQQGVRDPGGIWAKLGAAEASAERLQGRRSRG ASGSEPQQMGSDVRDLNALLPAVPSLGGGGGCALPVSGAAQWAPVLDFAPPGASAYGSLG GPAPPPAPPPPPPPPPHSFIKQEPSWGGAEPHEEQCLSAFTVHFSGQFTGTAGACRYGPF GPPPPSQASSGQARMFPNAPYLPSCLESQPAIRNQGYSTVTFDGTPSYGHTPSHHAAQFP NHSFKHEDPMGQQGSLGEQQYSVPPPVYGCHTPTDSCTGSQALLLRTPYSSDNLYQMTSQ LECMTWNQMNLGATLKGHSTGYESDNHTTPILCGAQYRIHTHGVFRGIQDVRRVPGVAPT LVRSASETSEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQ LKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELV RHHNMHQRNMTKLQLAL |
|
Copyright © 2016-Present - The Univsersity of Texas Health Science Center at Houston Rights Reserved |