|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 84152 |
Name | PPP1R1B |
Synonym | DARPP-32|DARPP32;protein phosphatase 1, regulatory (inhibitor) subunit 1B;PPP1R1B;protein phosphatase 1, regulatory (inhibitor) subunit 1B |
Definition | dopamine and cAMP-regulated neuronal phosphoprotein 32|protein phosphatase 1 regulatory subunit 1B |
Position | 17q12 |
Gene Type | protein-coding |
Source | Count: 1; Generif |
Literature support | Count: 1 PubMed records as below. |
|
Evidence Status |
Description |
potential | The decreased expression of DARPP-32 in oral premalignant and malignant lesions suggests a tumor suppressor role for this protein in the tumorigenesis of these lesions. |
| More detail of all 1 literatures about PPP1R1B | |
|
Pathways and Diseases |
|
Pathway | DARPP-32 events;PID Reactome;500841 |
Pathway | fosb gene expression and drug abuse;PID BioCarta;100161 |
Pathway | regulation of ck1/cdk5 by type 1 glutamate receptors;PID BioCarta;100201 |
Pathway | Opioid Signalling;Reactome;REACT:15295 |
Disease | nicotine smoking behavior;GAD |
Disease | alcohol consumption;GAD |
Disease | CHEMDEPENDENCY;GAD |
|
External Links |
|
Links to Entrez Gene | 84152 |
Links to all GeneRIF Items | 84152 |
Links to iHOP | 84152 |
|
Sequence Information |
|
Nucleotide Sequence |
>84152 : length: 615 atggaccccaaggaccgcaagaagatccagttctcggtgcccgcgccccctagccagctc gacccccgccaggtggagatgatccggcgcaggagaccaacgcctgccatgctgttccgg ctctcagagcactcctcaccagaggaggaagcctccccccaccagagagcctcaggagag gggcaccatctcaagtcgaagagacccaacccctgtgcctacacaccaccttcgctgaaa gctgtgcagcgcattgctgagtctcacctgcagtctatcagcaatttgaatgagaaccag gcctcagaggaggaggatgagctgggggagcttcgggagctgggttatccaagagaggaa gatgaggaggaagaggaggatgatgaagaagaggaagaagaagaggacagccaggctgaa gtcctgaaggtcatcaggcagtctgctgggcaaaagacaacctgtggccagggtctggaa gggccctgggagcgcccaccccctctggatgagtccgagagagatggaggctctgaggac caagtggaagacccagcactaagtgagcctggggaggaacctcagcgcccttccccctct gagcctggcacatag |
Protein Sequence |
>84152 : length: 204 MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPAMLFRLSEHSSPEEEASPHQRASGE GHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGYPREE DEEEEEDDEEEEEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSED QVEDPALSEPGEEPQRPSPSEPGT |