|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
Basic Information | |
|---|---|
Gene ID | 857 |
Name | CAV1 |
Synonym | BSCL3|CGL3|MSTP085|VIP21;caveolin 1, caveolae protein, 22kDa;CAV1;caveolin 1, caveolae protein, 22kDa |
Definition | caveolin-1|cell growth-inhibiting protein 32 |
Position | 7q31.1 |
Gene Type | protein-coding |
Source | Count: 3; Pubmed_search,TAG,Generif |
Literature support | Count: 10 PubMed records as below. |
Evidence Status | Description |
reviewed | "Chromosomal localization, genomic organization, and developmental expression of the murine caveolin gene family (Cav-1, -2, and -3). Cav-1 and Cav-2 genes map to a known tumor suppressor locus (6-A2/7q31)." |
potential | Global gene expression profiling and tissue microarray reveal novel candidate genes and down-regulation of the tumor suppressor gene CAV1 in sporadic vestibular schwannomas. |
potential | Caveolin-1 acts as a tumor suppressor by down-regulating epidermal growth factor receptor-mitogen-activated protein kinase signaling pathway in pancreatic carcinoma cell lines. |
reviewed | Cav-1 functions as a tumor suppressor in the stromal microenvironment. |
reviewed | "Results suggest different roles for CAV1 in SCLC, where CAV1 acts like a tumor suppressor gene, and NSCLC, where it appears required for survival and growth." |
potential | "Down-regulation of caveolin-1, a candidate tumor suppressor gene, in sarcomas." |
reviewed | "Cav-1 functions as a tumor promoter during prostate carcinogenesis, rather than as a tumor suppressor". |
reviewed | Cav-1 cooperates with the tumor suppressor INK4a genetic locus to prevent cell proliferation and oncogene-induced tumorigenesis. |
reviewed | Results provide the first genetic evidence that caveolin-1 indeed functions as a tumor suppressor gene in vivo. |
reviewed | Results indicate a central role for caveolin-1 in promoting cellular senescence and suggest the hypothesis that premature senescence may represent a tumor suppressor function mediated by caveolin-1 in vivo. |
| More detail of all 10 literatures about CAV1 | |
Pathways and Diseases | |
Pathway | Endocytosis;KEGG PATHWAY;hsa04144 |
Pathway | Direct p53 effectors;PID Curated;200101 |
Pathway | ALK1 signaling events;PID Curated;200126 |
Pathway | Basigin interactions;PID Reactome;500308 |
Pathway | VEGFR1 specific signals;PID Curated;200151 |
Pathway | ion channels and their functional role in vascular endothelium;PID BioCarta;100055 |
Pathway | NOSTRIN mediated eNOS trafficking;PID Reactome;500851 |
Pathway | PDGFR-alpha signaling pathway;PID Curated;200140 |
Pathway | Bacterial invasion of epithelial cells;KEGG PATHWAY;hsa05100 |
Pathway | TNF receptor signaling pathway;PID Curated;200086 |
Pathway | Focal adhesion;KEGG PATHWAY;hsa04510 |
Pathway | TGF-beta receptor signaling;PID Curated;200195 |
Pathway | corticosteroids and cardioprotection;PID BioCarta;100156 |
Pathway | eNOS activation;PID Reactome;500849 |
Pathway | Hormone-sensitive lipase (HSL)-mediated triacylglycerol hydrolysis;PID Reactome;500799 |
Pathway | Metabolism of nitric oxide;Reactome;REACT:12508 |
Pathway | Signaling events mediated by VEGFR1 and VEGFR2;PID Curated;200161 |
Pathway | Insulin Pathway;PID Curated;200012 |
Pathway | Canonical Wnt signaling pathway;PID Curated;200064 |
Pathway | Integrin signalling pathway;PANTHER;P00034 |
Pathway | actions of nitric oxide in the heart;PID BioCarta;100094 |
Pathway | Signaling events mediated by PTP1B;PID Curated;200033 |
Pathway | Viral myocarditis;KEGG PATHWAY;hsa05416 |
Pathway | Hemostasis;Reactome;REACT:604 |
Pathway | integrin signaling pathway;PID BioCarta;100123 |
Pathway | vegf hypoxia and angiogenesis;PID BioCarta;100006 |
Disease | Scleroderma;FunDO |
Disease | Primary biliary cirrhosis;FunDO |
Disease | Hypertension;FunDO |
Disease | Electrocardiographic traits;NHGRI |
Disease | Genetic disorders;KEGG DISEASE |
Disease | Lipodystrophy, congenital generalized, type 3;OMIM |
Disease | Systemic scleroderma;FunDO |
Disease | CARDIOVASCULAR;GAD |
Disease | Bladder cancer;FunDO |
Disease | Congenital generalized lipodystrophy;KEGG DISEASE;H00419 |
Disease | Pulmonary fibrosis;FunDO |
Disease | prostate cancer;GAD |
Disease | Other genetic disorders;KEGG DISEASE |
Disease | Glaucoma (primary open-angle);NHGRI |
Disease | Cancer;FunDO |
Disease | PR interval;NHGRI |
Disease | Oral cancer;FunDO |
Disease | CANCER;GAD |
Disease | Rabies;FunDO |
Disease | blood pressure, arterial hypertension;GAD |
External Links | |
Links to Entrez Gene | 857 |
Links to all GeneRIF Items | 857 |
Links to iHOP | 857 |
Sequence Information | |
Nucleotide Sequence | >857 : length: 444 atggcagacgagctgagcgagaagcaagtgtacgacgcgcacaccaaggagatcgacctg gtcaaccgcgaccctaaacacctcaacgatgacgtggtcaagattgactttgaagatgtg attgcagaaccagaagggacacacagttttgacggcatttggaaggccagcttcaccacc ttcactgtgacgaaatactggttttaccgcttgctgtctgccctctttggcatcccgatg gcactcatctggggcatttacttcgccattctctctttcctgcacatctgggcagttgta ccatgcattaagagcttcctgattgagattcagtgcatcagccgtgtctattccatctac gtccacaccgtctgtgacccactctttgaagctgttgggaaaatattcagcaatgtccgc atcaacttgcagaaagaaatataa |
Protein Sequence | >857 : length: 147 MADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTT FTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIY VHTVCDPLFEAVGKIFSNVRINLQKEI |
|
Copyright © 2016-Present - The Univsersity of Texas Health Science Center at Houston Rights Reserved |