|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 8651 |
Name | SOCS1 |
Synonym | CIS1|CISH1|JAB|SOCS-1|SSI-1|SSI1|TIP3;suppressor of cytokine signaling 1;SOCS1;suppressor of cytokine signaling 1 |
Definition | JAK binding protein|JAK-binding protein|STAT induced SH3 protein 1|STAT-induced STAT inhibitor 1|TIP-3|Tec-interacting protein 3|cytokine-inducible SH2 protein 1 |
Position | 16p13.13 |
Gene Type | protein-coding |
Source | Count: 2; Pubmed_search,Generif |
Literature support | Count: 8 PubMed records as below. |
|
Evidence Status |
Description |
reviewed | The involvement of SOCS1 in p53 activation and the DNA damage response defines a novel tumor suppressor pathway. |
reviewed | DNA methylation analysis of tumor suppressor genes in monoclonal gammopathy of undetermined significance. |
reviewed | SOCS-1 mutations qualify as a tumor suppressor in mediastinal b-cell lymphoma. |
reviewed | mediastinal B-cell lymphoma and hodgkin lymphoma cells share overlapping features and defective tumor suppressor gene SOCS-1 triggers an oncogenic pathway operative in both Hodgkin and non-Hodgkin lymphomas. |
reviewed | Mutations of the tumor suppressor gene SOCS-1 in classical Hodgkin lymphoma are frequent and associated with nuclear phospho-STAT5 accumulation. |
reviewed | These findings suggested that SOCS-1 may act as a tumor suppressor in at least some colorectal cancers and that SOCS-1 methylation may be a particular phenomenon related to a nearly onset of colorectal cancer. |
reviewed | The tumor suppressor activity of SOCS-1. |
reviewed | Data suggest that the Socs1 acts as classic tumor suppressor by preventing activation of STAT3; downregulation of Socs1 and consequent activation of STAT3 may be crucial in progression to hepatocellular carcinoma. |
| More detail of all 8 literatures about SOCS1 | |
|
Pathways and Diseases |
|
Pathway | Jak-STAT signaling pathway;KEGG PATHWAY;hsa04630 |
Pathway | Insulin signaling pathway;KEGG PATHWAY;hsa04910 |
Pathway | IL4-mediated signaling events;PID Curated;200018 |
Pathway | il-2 receptor beta chain in t cell activation;PID BioCarta;100129 |
Pathway | Ubiquitin mediated proteolysis;KEGG PATHWAY;hsa04120 |
Pathway | JAK/STAT signaling pathway;PANTHER;P00038 |
Pathway | IL2-mediated signaling events;PID Curated;200082 |
Pathway | Signaling events mediated by Stem cell factor receptor (c-Kit);PID Curated;200156 |
Pathway | IL12-mediated signaling events;PID Curated;200034 |
Pathway | Type II diabetes mellitus;KEGG PATHWAY;hsa04930 |
Pathway | Toxoplasmosis;KEGG PATHWAY;hsa05145 |
Pathway | IFN-gamma pathway;PID Curated;200110 |
Disease | IMMUNE;GAD |
Disease | Celiac Disease;GAD |
|
External Links |
|
Links to Entrez Gene | 8651 |
Links to all GeneRIF Items | 8651 |
Links to iHOP | 8651 |
|
Sequence Information |
|
Nucleotide Sequence |
>8651 : length: 636 atggtagcacacaaccaggtggcagccgacaatgcagtctccacagcagcagagccccga cggcggccagaaccttcctcctcttcctcctcctcgcccgcggcccccgcgcgcccgcgg ccgtgccccgcggtcccggccccggcccccggcgacacgcacttccgcacattccgttcg cacgccgattaccggcgcatcacgcgcgccagcgcgctcctggacgcctgcggattctac tgggggcccctgagcgtgcacggggcgcacgagcggctgcgcgccgagcccgtgggcacc ttcctggtgcgcgacagccgccagcggaactgctttttcgcccttagcgtgaagatggcc tcgggacccacgagcatccgcgtgcactttcaggccggccgctttcacctggatggcagc cgcgagagcttcgactgcctcttcgagctgctggagcactacgtggcggcgccgcgccgc atgctgggggccccgctgcgccagcgccgcgtgcggccgctgcaggagctgtgccgccag cgcatcgtggccaccgtgggccgcgagaacctggctcgcatccccctcaaccccgtcctc cgcgactacctgagctccttccccttccagatttga |
Protein Sequence |
>8651 : length: 211 MVAHNQVAADNAVSTAAEPRRRPEPSSSSSSSPAAPARPRPCPAVPAPAPGDTHFRTFRS HADYRRITRASALLDACGFYWGPLSVHGAHERLRAEPVGTFLVRDSRQRNCFFALSVKMA SGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVAAPRRMLGAPLRQRRVRPLQELCRQ RIVATVGRENLARIPLNPVLRDYLSSFPFQI |