|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 9021 |
Name | SOCS3 |
Synonym | ATOD4|CIS3|Cish3|SOCS-3|SSI-3|SSI3;suppressor of cytokine signaling 3;SOCS3;suppressor of cytokine signaling 3 |
Definition | CIS-3|STAT-induced STAT inhibitor 3|cytokine-induced SH2 protein 3|cytokine-inducible SH2 protein 3 |
Position | 17q25.3 |
Gene Type | protein-coding |
Source | Count: 1; Generif |
Literature support | Count: 2 PubMed records as below. |
|
Evidence Status |
Description |
reviewed | SOCS3 is a tumor suppressor in breast cancer cells that is regulated by PRL. |
potential | "By acting on cytokines and multiple proliferative pathways, SOCS3 modulates both physiological and neoplastic proliferative processes in the liver and may act as a tumor suppressor". |
| More detail of all 2 literatures about SOCS3 | |
|
Pathways and Diseases |
|
Pathway | Adipocytokine signaling pathway;KEGG PATHWAY;hsa04920 |
Pathway | Jak-STAT signaling pathway;KEGG PATHWAY;hsa04630 |
Pathway | Insulin signaling pathway;KEGG PATHWAY;hsa04910 |
Pathway | IL4-mediated signaling events;PID Curated;200018 |
Pathway | il-2 receptor beta chain in t cell activation;PID BioCarta;100129 |
Pathway | EPO signaling pathway;PID Curated;200157 |
Pathway | Inflammation mediated by chemokine and cytokine signaling pathway;PANTHER;P00031 |
Pathway | Ubiquitin mediated proteolysis;KEGG PATHWAY;hsa04120 |
Pathway | il22 soluble receptor signaling pathway;PID BioCarta;100131 |
Pathway | IL23-mediated signaling events;PID Curated;200131 |
Pathway | Interferon-gamma signaling pathway;PANTHER;P00035 |
Pathway | Signaling events mediated by PTP1B;PID Curated;200033 |
Pathway | IL6-mediated signaling events;PID Curated;200124 |
Pathway | IL2-mediated signaling events;PID Curated;200082 |
Pathway | ATF-2 transcription factor network;PID Curated;200116 |
Pathway | Hepatitis C;KEGG PATHWAY;hsa05160 |
Pathway | Type II diabetes mellitus;KEGG PATHWAY;hsa04930 |
Disease | Tuberculosis;FunDO |
Disease | Prostate cancer;FunDO |
Disease | Metastasis to lymph nodes;FunDO |
Disease | Dermatitis, atopic, susceptibility to, 4;OMIM |
Disease | Liver tumor;FunDO |
Disease | Polycystic ovary syndrome;FunDO |
Disease | Lung cancer;FunDO |
Disease | Obesity;FunDO |
Disease | Leukemia;FunDO |
Disease | Melanoma;FunDO |
Disease | Polyarthritis;FunDO |
Disease | Uveitis;FunDO |
Disease | Breast cancer;FunDO |
Disease | Adenovirus infection;FunDO |
Disease | Cervical cancer;FunDO |
Disease | Ulcerative colitis;FunDO |
Disease | Cholangiocarcinoma;FunDO |
|
External Links |
|
Links to Entrez Gene | 9021 |
Links to all GeneRIF Items | 9021 |
Links to iHOP | 9021 |
|
Sequence Information |
|
Nucleotide Sequence |
>9021 : length: 678 atggtcacccacagcaagtttcccgccgccgggatgagccgccccctggacaccagcctg cgcctcaagaccttcagctccaagagcgagtaccagctggtggtgaacgcagtgcgcaag ctgcaggagagcggcttctactggagcgcagtgaccggcggcgaggcgaacctgctgctc agtgccgagcccgccggcacctttctgatccgcgacagctcggaccagcgccacttcttc acgctcagcgtcaagacccagtctgggaccaagaacctgcgcatccagtgtgaggggggc agcttctctctgcagagcgatccccggagcacgcagcccgtgccccgcttcgactgcgtg ctcaagctggtgcaccactacatgccgccccctggagccccctccttcccctcgccacct actgaaccctcctccgaggtgcccgagcagccgtctgcccagccactccctgggagtccc cccagaagagcctattacatctactccgggggcgagaagatccccctggtgttgagccgg cccctctcctccaacgtggccactcttcagcatctctgtcggaagaccgtcaacggccac ctggactcctatgagaaagtcacccagctgccggggcccattcgggagttcctggaccag tacgatgccccgctttaa |
Protein Sequence |
>9021 : length: 225 MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLL SAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCV LKLVHHYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSR PLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL |