|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
Basic Information | |
|---|---|
Gene ID | 9636 |
Name | ISG15 |
Synonym | G1P2|IFI15|IP17|UCRP|hUCRP;ISG15 ubiquitin-like modifier;ISG15;ISG15 ubiquitin-like modifier |
Definition | interferon, alpha-inducible protein (clone IFI-15K)|interferon-induced 15 kDa protein|interferon-induced 17 kDa protein|interferon-induced 17-kDa/15-kDa protein|interferon-stimulated protein, 15 kDa|ubiquitin cross-reactive protein|ubiquitin-like protein |
Position | 1p36.33 |
Gene Type | protein-coding |
Source | Count: 1; Generif |
Literature support | Count: 1 PubMed records as below. |
Evidence Status | Description |
reviewed | "review evidence of a role for ISG15 as an endogenous tumor suppressor that, when dysregulated in malignant cells, can be subverted to promote oncogenesis". |
| More detail of all 1 literatures about ISG15 | |
Pathways and Diseases | |
Pathway | RIG-I-like receptor signaling pathway;KEGG PATHWAY;hsa04622 |
Disease | Melanoma;FunDO |
Disease | Rheumatoid arthritis;FunDO |
External Links | |
Links to Entrez Gene | 9636 |
Links to all GeneRIF Items | 9636 |
Links to iHOP | 9636 |
Sequence Information | |
Nucleotide Sequence | >9636 : length: 498 atgggctgggacctgacggtgaagatgctggcgggcaacgaattccaggtgtccctgagc agctccatgtcggtgtcagagctgaaggcgcagatcacccagaagatcggcgtgcacgcc ttccagcagcgtctggctgtccacccgagcggtgtggcgctgcaggacagggtccccctt gccagccagggcctgggccccggcagcacggtcctgctggtggtggacaaatgcgacgaa cctctgagcatcctggtgaggaataacaagggccgcagcagcacctacgaggtacggctg acgcagaccgtggcccacctgaagcagcaagtgagcgggctggagggtgtgcaggacgac ctgttctggctgaccttcgaggggaagcccctggaggaccagctcccgctgggggagtac ggcctcaagcccctgagcaccgtgttcatgaatctgcgcctgcggggaggcggcacagag cctggcgggcggagctaa |
Protein Sequence | >9636 : length: 165 MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPL ASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDD LFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGGGTEPGGRS |
|
Copyright © 2016-Present - The Univsersity of Texas Health Science Center at Houston Rights Reserved |