|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 9978 |
Name | RBX1 |
Synonym | BA554C12.1|RNF75|ROC1;ring-box 1, E3 ubiquitin protein ligase;RBX1;ring-box 1, E3 ubiquitin protein ligase |
Definition | E3 ubiquitin-protein ligase RBX1|RING box protein 1|RING finger protein 75|RING-box protein 1|ZYP protein|regulator of cullins 1 |
Position | 22q13.2 |
Gene Type | protein-coding |
Source | Count: 1; TAG |
Literature support | Count: 0 PubMed records as below. |
|
Evidence Status |
Description |
| . |
| More detail of all 0 literatures about RBX1 | |
|
Pathways and Diseases |
|
Pathway | HIV Infection;Reactome;REACT:6185 |
Pathway | Wnt signaling pathway;KEGG PATHWAY;hsa04310 |
Pathway | Signaling in Immune system;Reactome;REACT:6900 |
Pathway | Hypoxic and oxygen homeostasis regulation of HIF-1-alpha;PID Curated;200122 |
Pathway | Ubiquitin mediated proteolysis;KEGG PATHWAY;hsa04120 |
Pathway | Renal cell carcinoma;KEGG PATHWAY;hsa05211 |
Pathway | Interleukin-1 signaling;PID Reactome;500490 |
Pathway | Oocyte meiosis;KEGG PATHWAY;hsa04114 |
Pathway | Cell cycle;KEGG PATHWAY;hsa04110 |
Pathway | Nucleotide excision repair;KEGG PATHWAY;hsa03420 |
Pathway | TGF-beta signaling pathway;KEGG PATHWAY;hsa04350 |
Pathway | Circadian rhythm - mammal;KEGG PATHWAY;hsa04710 |
Pathway | Pathways in cancer;KEGG PATHWAY;hsa05200 |
Pathway | Protein processing in endoplasmic reticulum;KEGG PATHWAY;hsa04141 |
Pathway | regulation of p27 phosphorylation during cell cycle progression;PID BioCarta;100087 |
|
External Links |
|
Links to Entrez Gene | 9978 |
Links to all GeneRIF Items | 9978 |
Links to iHOP | 9978 |
|
Sequence Information |
|
Nucleotide Sequence |
>9978 : length: 327 atggcggcagcgatggatgtggataccccgagcggcaccaacagcggcgcgggcaagaag cgctttgaagtgaaaaagtggaatgcagtagccctctgggcctgggatattgtggttgat aactgtgccatctgcaggaaccacattatggatctttgcatagaatgtcaagctaaccag gcgtccgctacttcagaagagtgtactgtcgcatggggagtctgtaaccatgcttttcac ttccactgcatctctcgctggctcaaaacacgacaggtgtgtccattggacaacagagag tgggaattccaaaagtatgggcactag |
Protein Sequence |
>9978 : length: 108 MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH |